BLASTX nr result
ID: Alisma22_contig00001171
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00001171 (670 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012088816.1 PREDICTED: hydrophobic protein LTI6B-like [Jatrop... 84 4e-18 OAY42463.1 hypothetical protein MANES_09G181700 [Manihot esculenta] 80 2e-16 XP_008776670.1 PREDICTED: hydrophobic protein LTI6B [Phoenix dac... 79 3e-16 XP_015874794.1 PREDICTED: hydrophobic protein RCI2B-like [Ziziph... 79 5e-16 XP_010271058.1 PREDICTED: hydrophobic protein RCI2B [Nelumbo nuc... 79 7e-16 XP_008776673.1 PREDICTED: hydrophobic protein RCI2B-like [Phoeni... 79 7e-16 XP_010694119.1 PREDICTED: hydrophobic protein LTI6A [Beta vulgar... 78 9e-16 XP_006428346.1 hypothetical protein CICLE_v10013304mg [Citrus cl... 78 1e-15 KQL03565.1 hypothetical protein SETIT_003690mg [Setaria italica]... 77 2e-15 NP_001147403.2 hydrophobic protein LTI6A [Zea mays] ACF80942.1 u... 77 3e-15 GAU11401.1 hypothetical protein TSUD_343920 [Trifolium subterran... 77 3e-15 AAQ84111.1 Clt1 [Citrus trifoliata] 77 3e-15 XP_020108062.1 hydrophobic protein LTI6A [Ananas comosus] 77 4e-15 XP_006428345.1 hypothetical protein CICLE_v10013710mg, partial [... 77 6e-15 KQL26843.1 hypothetical protein SETIT_031814mg [Setaria italica]... 76 7e-15 XP_014511134.1 PREDICTED: hydrophobic protein RCI2B [Vigna radia... 76 7e-15 NP_001147508.1 uncharacterized protein LOC100281117 [Zea mays] A... 76 7e-15 XP_019702864.1 PREDICTED: hydrophobic protein RCI2B-like [Elaeis... 76 8e-15 KQL03568.1 hypothetical protein SETIT_003690mg [Setaria italica]... 75 1e-14 ACG27364.1 hydrophobic protein LTI6A [Zea mays] ACG47392.1 hydro... 75 1e-14 >XP_012088816.1 PREDICTED: hydrophobic protein LTI6B-like [Jatropha curcas] ACV50425.1 cold induced plasma membrane protein [Jatropha curcas] KDP23328.1 hypothetical protein JCGZ_23161 [Jatropha curcas] Length = 57 Score = 84.3 bits (207), Expect = 4e-18 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 595 MPSEGTATCFDIILAIILPPLGVFLKFGCKAEFWICLVLTFL 470 MPSEGTATC DI+LA+ILPPLGVFLKFGCKAEFWICL+LT L Sbjct: 1 MPSEGTATCIDILLAVILPPLGVFLKFGCKAEFWICLLLTIL 42 >OAY42463.1 hypothetical protein MANES_09G181700 [Manihot esculenta] Length = 57 Score = 80.1 bits (196), Expect = 2e-16 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -1 Query: 595 MPSEGTATCFDIILAIILPPLGVFLKFGCKAEFWICLVLTF 473 M EGTATC DI+LAI+LPPLGVFLK+GCKAEFWICLVLTF Sbjct: 1 MADEGTATCIDILLAILLPPLGVFLKYGCKAEFWICLVLTF 41 >XP_008776670.1 PREDICTED: hydrophobic protein LTI6B [Phoenix dactylifera] XP_008776671.1 PREDICTED: hydrophobic protein LTI6B [Phoenix dactylifera] Length = 57 Score = 79.3 bits (194), Expect = 3e-16 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -1 Query: 595 MPSEGTATCFDIILAIILPPLGVFLKFGCKAEFWICLVLTFL 470 M EGTATC DI++AIILPPLGVFLKFGCKAEFWICL+LT L Sbjct: 1 MADEGTATCLDILIAIILPPLGVFLKFGCKAEFWICLLLTIL 42 >XP_015874794.1 PREDICTED: hydrophobic protein RCI2B-like [Ziziphus jujuba] Length = 57 Score = 79.0 bits (193), Expect = 5e-16 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -1 Query: 595 MPSEGTATCFDIILAIILPPLGVFLKFGCKAEFWICLVLTFL 470 MP EGTA C DI+LAIILPPLGVFLKFGCK EFWICL+LT L Sbjct: 1 MPREGTAKCIDILLAIILPPLGVFLKFGCKVEFWICLLLTLL 42 >XP_010271058.1 PREDICTED: hydrophobic protein RCI2B [Nelumbo nucifera] Length = 57 Score = 78.6 bits (192), Expect = 7e-16 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -1 Query: 595 MPSEGTATCFDIILAIILPPLGVFLKFGCKAEFWICLVLT 476 M SEGTATC DI+LAIILPPLGVFLKFGCK EFWICL+LT Sbjct: 1 MASEGTATCIDILLAIILPPLGVFLKFGCKVEFWICLLLT 40 >XP_008776673.1 PREDICTED: hydrophobic protein RCI2B-like [Phoenix dactylifera] XP_017696000.1 PREDICTED: hydrophobic protein RCI2B-like [Phoenix dactylifera] Length = 57 Score = 78.6 bits (192), Expect = 7e-16 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -1 Query: 595 MPSEGTATCFDIILAIILPPLGVFLKFGCKAEFWICLVLT 476 MPSEGT C DI+LAIILPPLGVFLKFGCK EFW+CLVLT Sbjct: 1 MPSEGTVNCIDILLAIILPPLGVFLKFGCKVEFWLCLVLT 40 >XP_010694119.1 PREDICTED: hydrophobic protein LTI6A [Beta vulgaris subsp. vulgaris] KMS98602.1 hypothetical protein BVRB_3g070450 [Beta vulgaris subsp. vulgaris] Length = 56 Score = 78.2 bits (191), Expect = 9e-16 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = -1 Query: 589 SEGTATCFDIILAIILPPLGVFLKFGCKAEFWICLVLTF 473 SE TATC DI+LAIILPPLGVFLKFGCK EFWICLVLTF Sbjct: 2 SESTATCIDILLAIILPPLGVFLKFGCKVEFWICLVLTF 40 >XP_006428346.1 hypothetical protein CICLE_v10013304mg [Citrus clementina] XP_006428347.1 hypothetical protein CICLE_v10013304mg [Citrus clementina] XP_006480340.1 PREDICTED: hydrophobic protein RCI2B [Citrus sinensis] ESR41586.1 hypothetical protein CICLE_v10013304mg [Citrus clementina] ESR41587.1 hypothetical protein CICLE_v10013304mg [Citrus clementina] KDO56401.1 hypothetical protein CISIN_1g035460mg [Citrus sinensis] KDO56402.1 hypothetical protein CISIN_1g035460mg [Citrus sinensis] Length = 58 Score = 77.8 bits (190), Expect = 1e-15 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -1 Query: 595 MPSEGTATCFDIILAIILPPLGVFLKFGCKAEFWICLVLT 476 M EGTATC DIILAIILPPLGVFLKFGCK EFWICL+LT Sbjct: 1 MADEGTATCIDIILAIILPPLGVFLKFGCKVEFWICLLLT 40 >KQL03565.1 hypothetical protein SETIT_003690mg [Setaria italica] KQL03566.1 hypothetical protein SETIT_003690mg [Setaria italica] KQL03567.1 hypothetical protein SETIT_003690mg [Setaria italica] Length = 56 Score = 77.4 bits (189), Expect = 2e-15 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -1 Query: 589 SEGTATCFDIILAIILPPLGVFLKFGCKAEFWICLVLTFL 470 SEGTA C DI++AIILPPLGVFLKFGCK EFWICL+LTFL Sbjct: 2 SEGTANCIDILIAIILPPLGVFLKFGCKFEFWICLLLTFL 41 >NP_001147403.2 hydrophobic protein LTI6A [Zea mays] ACF80942.1 unknown [Zea mays] ACG25252.1 hydrophobic protein LTI6A [Zea mays] ACG48645.1 hydrophobic protein LTI6A [Zea mays] ONM59976.1 proteolipid membrane potential regulator5 [Zea mays] Length = 56 Score = 77.0 bits (188), Expect = 3e-15 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -1 Query: 589 SEGTATCFDIILAIILPPLGVFLKFGCKAEFWICLVLTFL 470 S+GTATC DIILAIILPPLGVF KFGC EFWICL+LTFL Sbjct: 2 SDGTATCIDIILAIILPPLGVFFKFGCGVEFWICLILTFL 41 >GAU11401.1 hypothetical protein TSUD_343920 [Trifolium subterraneum] Length = 54 Score = 76.6 bits (187), Expect = 3e-15 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -1 Query: 583 GTATCFDIILAIILPPLGVFLKFGCKAEFWICLVLTFL 470 GTATC DIILAIILPPLGVFLKFGCK EFWICL+LT L Sbjct: 2 GTATCIDIILAIILPPLGVFLKFGCKVEFWICLILTIL 39 >AAQ84111.1 Clt1 [Citrus trifoliata] Length = 54 Score = 76.6 bits (187), Expect = 3e-15 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 583 GTATCFDIILAIILPPLGVFLKFGCKAEFWICLVLTFL 470 GTATC DIILA+ILPPLGVFLKFGCKAEFWICL+LT L Sbjct: 2 GTATCVDIILAVILPPLGVFLKFGCKAEFWICLLLTIL 39 >XP_020108062.1 hydrophobic protein LTI6A [Ananas comosus] Length = 57 Score = 76.6 bits (187), Expect = 4e-15 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -1 Query: 595 MPSEGTATCFDIILAIILPPLGVFLKFGCKAEFWICLVLTFL 470 M + TATC DI+LAIILPPLGVFLKFGCK EFWICL+LTF+ Sbjct: 1 MADDSTATCIDILLAIILPPLGVFLKFGCKVEFWICLLLTFI 42 >XP_006428345.1 hypothetical protein CICLE_v10013710mg, partial [Citrus clementina] ESR41585.1 hypothetical protein CICLE_v10013710mg, partial [Citrus clementina] Length = 104 Score = 77.4 bits (189), Expect = 6e-15 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = -1 Query: 616 IYPPQANMPSEGTATCFDIILAIILPPLGVFLKFGCKAEFWICLVLTFL 470 ++ Q+ M TATC DI+LA+ILPPLGVFLKFGCKAEFWICL+LT L Sbjct: 40 LFKNQSKMADGSTATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTIL 88 >KQL26843.1 hypothetical protein SETIT_031814mg [Setaria italica] KQL26844.1 hypothetical protein SETIT_031814mg [Setaria italica] Length = 56 Score = 75.9 bits (185), Expect = 7e-15 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = -1 Query: 589 SEGTATCFDIILAIILPPLGVFLKFGCKAEFWICLVLTF 473 S+GTATC DIILAIILPPLGVF KFGC EFWICLVLTF Sbjct: 2 SDGTATCIDIILAIILPPLGVFFKFGCGVEFWICLVLTF 40 >XP_014511134.1 PREDICTED: hydrophobic protein RCI2B [Vigna radiata var. radiata] XP_017413861.1 PREDICTED: hydrophobic protein RCI2B [Vigna angularis] KOM35416.1 hypothetical protein LR48_Vigan02g156600 [Vigna angularis] Length = 57 Score = 75.9 bits (185), Expect = 7e-15 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -1 Query: 595 MPSEGTATCFDIILAIILPPLGVFLKFGCKAEFWICLVLT 476 M +GTATC DI+LAIILPPLGVFLK+GCK EFWICLVLT Sbjct: 1 MAGDGTATCIDILLAIILPPLGVFLKYGCKVEFWICLVLT 40 >NP_001147508.1 uncharacterized protein LOC100281117 [Zea mays] ACG27760.1 hydrophobic protein LTI6B [Zea mays] AQK89177.1 Hydrophobic protein LTI6B [Zea mays] Length = 57 Score = 75.9 bits (185), Expect = 7e-15 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 586 EGTATCFDIILAIILPPLGVFLKFGCKAEFWICLVLTFL 470 EGTA C DI++AIILPPLGVFLKFGCK EFW+CL+LTFL Sbjct: 3 EGTANCIDILIAIILPPLGVFLKFGCKVEFWLCLLLTFL 41 >XP_019702864.1 PREDICTED: hydrophobic protein RCI2B-like [Elaeis guineensis] Length = 59 Score = 75.9 bits (185), Expect = 8e-15 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -1 Query: 595 MPSEGTATCFDIILAIILPPLGVFLKFGCKAEFWICLVLT 476 M EGT TC DI++AIILPPLGVFLKFGCK EFWICLVLT Sbjct: 1 MADEGTVTCIDILIAIILPPLGVFLKFGCKVEFWICLVLT 40 >KQL03568.1 hypothetical protein SETIT_003690mg [Setaria italica] KQL03569.1 hypothetical protein SETIT_003690mg [Setaria italica] Length = 56 Score = 75.5 bits (184), Expect = 1e-14 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 586 EGTATCFDIILAIILPPLGVFLKFGCKAEFWICLVLTFL 470 EGTA C DI++AIILPPLGVFLKFGCK EFWICL+LTFL Sbjct: 3 EGTANCVDILIAIILPPLGVFLKFGCKFEFWICLLLTFL 41 >ACG27364.1 hydrophobic protein LTI6A [Zea mays] ACG47392.1 hydrophobic protein LTI6A [Zea mays] Length = 56 Score = 75.5 bits (184), Expect = 1e-14 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -1 Query: 589 SEGTATCFDIILAIILPPLGVFLKFGCKAEFWICLVLTF 473 S+GTATC DIILAIILPPLGVF KFGC EFWICL+LTF Sbjct: 2 SDGTATCIDIILAIILPPLGVFFKFGCGVEFWICLILTF 40