BLASTX nr result
ID: Alisma22_contig00001093
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00001093 (456 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014497797.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-l... 125 4e-34 KOM36652.1 hypothetical protein LR48_Vigan03g003300 [Vigna angul... 125 7e-34 XP_008362581.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-l... 123 1e-33 AER12038.1 ubiquitin extension protein, partial [Paeonia suffrut... 124 1e-33 XP_003613203.1 ubiquitin-40S ribosomal S27a-like protein [Medica... 124 1e-33 KMZ62420.1 Ubiquitin-40S ribosomal protein S27a-1 [Zostera marina] 124 1e-33 XP_004504241.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 124 2e-33 XP_004489824.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 124 2e-33 XP_019710497.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-l... 124 2e-33 XP_014499622.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 124 2e-33 NP_001238181.1 uncharacterized protein LOC100527579 [Glycine max... 124 2e-33 AMK47984.1 putative ubiquitin-40s ribosomal s27a-like protein [L... 122 3e-33 CAA80334.1 ubiquitin extension protein [Lupinus albus] 123 3e-33 XP_008389677.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [... 123 4e-33 KVH89700.1 Ribosomal protein S27a [Cynara cardunculus var. scoly... 122 4e-33 XP_014497798.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-l... 123 5e-33 KRH11776.1 hypothetical protein GLYMA_15G129800 [Glycine max] 123 5e-33 XP_003629895.2 ubiquitin-40S ribosomal S27a-like protein [Medica... 123 5e-33 XP_007157375.1 hypothetical protein PHAVU_002G065000g [Phaseolus... 123 5e-33 NP_001269170.1 ubiquitin-40S ribosomal protein S27a-like [Cucumi... 123 5e-33 >XP_014497797.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Vigna radiata var. radiata] XP_017418784.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Vigna angularis] XP_017418785.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Vigna angularis] Length = 155 Score = 125 bits (315), Expect = 4e-34 Identities = 57/61 (93%), Positives = 58/61 (95%) Frame = -1 Query: 456 KHKKVKLAVLQFYKVDDSGKVARLRKECPNAECGAGTFMASHHDRHYCGKCGLTYVYAKA 277 KHKKVKLAVLQFYKVDDSGKV RLRKECPNAECGAGTFMA+H DRHYCGKCGLTYVY KA Sbjct: 94 KHKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 Query: 276 D 274 D Sbjct: 154 D 154 >KOM36652.1 hypothetical protein LR48_Vigan03g003300 [Vigna angularis] Length = 170 Score = 125 bits (315), Expect = 7e-34 Identities = 57/61 (93%), Positives = 58/61 (95%) Frame = -1 Query: 456 KHKKVKLAVLQFYKVDDSGKVARLRKECPNAECGAGTFMASHHDRHYCGKCGLTYVYAKA 277 KHKKVKLAVLQFYKVDDSGKV RLRKECPNAECGAGTFMA+H DRHYCGKCGLTYVY KA Sbjct: 109 KHKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 168 Query: 276 D 274 D Sbjct: 169 D 169 >XP_008362581.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like, partial [Malus domestica] Length = 115 Score = 123 bits (309), Expect = 1e-33 Identities = 56/60 (93%), Positives = 57/60 (95%) Frame = -1 Query: 456 KHKKVKLAVLQFYKVDDSGKVARLRKECPNAECGAGTFMASHHDRHYCGKCGLTYVYAKA 277 KHKKVKLAVLQFYKVDDSGKV RLRKECPNAECGAGTFMA+H DRHYCGKCGLTYVY KA Sbjct: 53 KHKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 112 >AER12038.1 ubiquitin extension protein, partial [Paeonia suffruticosa] Length = 140 Score = 124 bits (311), Expect = 1e-33 Identities = 56/63 (88%), Positives = 58/63 (92%) Frame = -1 Query: 456 KHKKVKLAVLQFYKVDDSGKVARLRKECPNAECGAGTFMASHHDRHYCGKCGLTYVYAKA 277 KHKKVKLAVLQFYKVDDSGKV RLRKECPN +CGAGTFMA+H DRHYCGKCGLTYVY KA Sbjct: 78 KHKKVKLAVLQFYKVDDSGKVQRLRKECPNGDCGAGTFMANHFDRHYCGKCGLTYVYKKA 137 Query: 276 DDE 268 DE Sbjct: 138 ADE 140 >XP_003613203.1 ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula] AES96161.1 ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula] Length = 155 Score = 124 bits (312), Expect = 1e-33 Identities = 56/61 (91%), Positives = 58/61 (95%) Frame = -1 Query: 456 KHKKVKLAVLQFYKVDDSGKVARLRKECPNAECGAGTFMASHHDRHYCGKCGLTYVYAKA 277 KH+KVKLAVLQFYKVDDSGKV RLRKECPNAECGAGTFMA+H DRHYCGKCGLTYVY KA Sbjct: 94 KHRKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 Query: 276 D 274 D Sbjct: 154 D 154 >KMZ62420.1 Ubiquitin-40S ribosomal protein S27a-1 [Zostera marina] Length = 156 Score = 124 bits (312), Expect = 1e-33 Identities = 55/63 (87%), Positives = 59/63 (93%) Frame = -1 Query: 456 KHKKVKLAVLQFYKVDDSGKVARLRKECPNAECGAGTFMASHHDRHYCGKCGLTYVYAKA 277 KHKKVKLAVLQFYKVDDSGKV RLRKECPN ECGAGTFMA+H DRHYCGKCG+TYVY+KA Sbjct: 94 KHKKVKLAVLQFYKVDDSGKVVRLRKECPNGECGAGTFMANHFDRHYCGKCGMTYVYSKA 153 Query: 276 DDE 268 +E Sbjct: 154 GEE 156 >XP_004504241.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Cicer arietinum] Length = 155 Score = 124 bits (311), Expect = 2e-33 Identities = 56/61 (91%), Positives = 58/61 (95%) Frame = -1 Query: 456 KHKKVKLAVLQFYKVDDSGKVARLRKECPNAECGAGTFMASHHDRHYCGKCGLTYVYAKA 277 KHKKVKLAVLQFYKVDDSGKV RLRKECPNAECGAGTFMA+H DRHYCGKCGLTYVY KA Sbjct: 94 KHKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 Query: 276 D 274 + Sbjct: 154 E 154 >XP_004489824.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Cicer arietinum] Length = 155 Score = 124 bits (311), Expect = 2e-33 Identities = 56/61 (91%), Positives = 57/61 (93%) Frame = -1 Query: 456 KHKKVKLAVLQFYKVDDSGKVARLRKECPNAECGAGTFMASHHDRHYCGKCGLTYVYAKA 277 KHKKVKLAVLQFYKVDDSGKV RLRKECPNAECGAGTFMA+H DRHYCGKCGLTYVY K Sbjct: 94 KHKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKT 153 Query: 276 D 274 D Sbjct: 154 D 154 >XP_019710497.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Elaeis guineensis] Length = 156 Score = 124 bits (311), Expect = 2e-33 Identities = 57/63 (90%), Positives = 58/63 (92%) Frame = -1 Query: 456 KHKKVKLAVLQFYKVDDSGKVARLRKECPNAECGAGTFMASHHDRHYCGKCGLTYVYAKA 277 K KKVKLAVLQFYKVDDSGKV RLRKECPNAECGAGTFMA+H DRHYCGKCGLTYVY KA Sbjct: 94 KKKKVKLAVLQFYKVDDSGKVTRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 Query: 276 DDE 268 DE Sbjct: 154 GDE 156 >XP_014499622.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Vigna radiata var. radiata] XP_017423173.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Vigna angularis] KOM43071.1 hypothetical protein LR48_Vigan05g067500 [Vigna angularis] BAT92844.1 hypothetical protein VIGAN_07168900 [Vigna angularis var. angularis] Length = 155 Score = 124 bits (310), Expect = 2e-33 Identities = 55/61 (90%), Positives = 57/61 (93%) Frame = -1 Query: 456 KHKKVKLAVLQFYKVDDSGKVARLRKECPNAECGAGTFMASHHDRHYCGKCGLTYVYAKA 277 KHKKVKLA+LQFYKVDDSGKV RLRKECPN ECGAGTFMA+H DRHYCGKCGLTYVY KA Sbjct: 94 KHKKVKLAILQFYKVDDSGKVQRLRKECPNTECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 Query: 276 D 274 D Sbjct: 154 D 154 >NP_001238181.1 uncharacterized protein LOC100527579 [Glycine max] XP_003517689.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Glycine max] ACU16690.1 unknown [Glycine max] KHN00366.1 Ubiquitin-40S ribosomal protein S27a [Glycine soja] KHN14565.1 Ubiquitin-40S ribosomal protein S27a [Glycine soja] KRH69588.1 hypothetical protein GLYMA_02G036000 [Glycine max] KRH74571.1 hypothetical protein GLYMA_01G029200 [Glycine max] Length = 155 Score = 124 bits (310), Expect = 2e-33 Identities = 55/61 (90%), Positives = 57/61 (93%) Frame = -1 Query: 456 KHKKVKLAVLQFYKVDDSGKVARLRKECPNAECGAGTFMASHHDRHYCGKCGLTYVYAKA 277 KHKKVKL +LQFYKVDDSGKV RLRKECPNAECGAGTFMA+H DRHYCGKCGLTYVY KA Sbjct: 94 KHKKVKLGILQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 Query: 276 D 274 D Sbjct: 154 D 154 >AMK47984.1 putative ubiquitin-40s ribosomal s27a-like protein [Lupinus angustifolius] Length = 130 Score = 122 bits (307), Expect = 3e-33 Identities = 55/61 (90%), Positives = 57/61 (93%) Frame = -1 Query: 456 KHKKVKLAVLQFYKVDDSGKVARLRKECPNAECGAGTFMASHHDRHYCGKCGLTYVYAKA 277 KHKKVKLA+LQFYKVDDSGKV RLRKECPNAECGAGTFMA+H DRHYCGKCG TYVY KA Sbjct: 69 KHKKVKLALLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGTTYVYQKA 128 Query: 276 D 274 D Sbjct: 129 D 129 >CAA80334.1 ubiquitin extension protein [Lupinus albus] Length = 155 Score = 123 bits (309), Expect = 3e-33 Identities = 56/61 (91%), Positives = 57/61 (93%) Frame = -1 Query: 456 KHKKVKLAVLQFYKVDDSGKVARLRKECPNAECGAGTFMASHHDRHYCGKCGLTYVYAKA 277 KHKKVKLAVLQFYKVDDSGKV RLRKECPNAECGAGTFMA+H DRHYCGKCG TYVY KA Sbjct: 94 KHKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGQTYVYQKA 153 Query: 276 D 274 D Sbjct: 154 D 154 >XP_008389677.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica] XP_008389867.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica] XP_008343199.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica] XP_008350959.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica] XP_008353873.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica] XP_008360710.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica] XP_009367168.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Pyrus x bretschneideri] XP_009376181.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Pyrus x bretschneideri] XP_018504408.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Pyrus x bretschneideri] XP_018507334.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Pyrus x bretschneideri] Length = 156 Score = 123 bits (309), Expect = 4e-33 Identities = 56/60 (93%), Positives = 57/60 (95%) Frame = -1 Query: 456 KHKKVKLAVLQFYKVDDSGKVARLRKECPNAECGAGTFMASHHDRHYCGKCGLTYVYAKA 277 KHKKVKLAVLQFYKVDDSGKV RLRKECPNAECGAGTFMA+H DRHYCGKCGLTYVY KA Sbjct: 94 KHKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >KVH89700.1 Ribosomal protein S27a [Cynara cardunculus var. scolymus] Length = 123 Score = 122 bits (306), Expect = 4e-33 Identities = 55/60 (91%), Positives = 57/60 (95%) Frame = -1 Query: 456 KHKKVKLAVLQFYKVDDSGKVARLRKECPNAECGAGTFMASHHDRHYCGKCGLTYVYAKA 277 KHKKVKL+VLQFYKVDDSGKV RLRKECPNAECGAGTFMA+H DRHYCGKCGLTYVY KA Sbjct: 61 KHKKVKLSVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 120 >XP_014497798.1 PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Vigna radiata var. radiata] Length = 155 Score = 123 bits (308), Expect = 5e-33 Identities = 56/61 (91%), Positives = 57/61 (93%) Frame = -1 Query: 456 KHKKVKLAVLQFYKVDDSGKVARLRKECPNAECGAGTFMASHHDRHYCGKCGLTYVYAKA 277 KHKKVKLAVLQ YKVDDSGKV RLRKECPNAECGAGTFMA+H DRHYCGKCGLTYVY KA Sbjct: 94 KHKKVKLAVLQXYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 Query: 276 D 274 D Sbjct: 154 D 154 >KRH11776.1 hypothetical protein GLYMA_15G129800 [Glycine max] Length = 155 Score = 123 bits (308), Expect = 5e-33 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = -1 Query: 456 KHKKVKLAVLQFYKVDDSGKVARLRKECPNAECGAGTFMASHHDRHYCGKCGLTYVYAKA 277 KHKKVKLA+LQFYKVDDSGKV RLRKECPNAECGAGTFMA+H DRHYCGKCGLTYVY KA Sbjct: 94 KHKKVKLALLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 Query: 276 D 274 + Sbjct: 154 E 154 >XP_003629895.2 ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula] ACJ83917.1 unknown [Medicago truncatula] ACJ86209.1 unknown [Medicago truncatula] AET04371.2 ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula] Length = 155 Score = 123 bits (308), Expect = 5e-33 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = -1 Query: 456 KHKKVKLAVLQFYKVDDSGKVARLRKECPNAECGAGTFMASHHDRHYCGKCGLTYVYAKA 277 KH+KVKLAVLQFYKVDDSGKV RLRKECPNAECGAGTFMA+H DRHYCGKCGLTYVY KA Sbjct: 94 KHRKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 Query: 276 D 274 + Sbjct: 154 E 154 >XP_007157375.1 hypothetical protein PHAVU_002G065000g [Phaseolus vulgaris] XP_007157378.1 hypothetical protein PHAVU_002G065200g [Phaseolus vulgaris] ESW29369.1 hypothetical protein PHAVU_002G065000g [Phaseolus vulgaris] ESW29372.1 hypothetical protein PHAVU_002G065200g [Phaseolus vulgaris] Length = 155 Score = 123 bits (308), Expect = 5e-33 Identities = 55/60 (91%), Positives = 57/60 (95%) Frame = -1 Query: 456 KHKKVKLAVLQFYKVDDSGKVARLRKECPNAECGAGTFMASHHDRHYCGKCGLTYVYAKA 277 KHKKVKLA+LQFYKVDDSGKV RLRKECPNAECGAGTFMA+H DRHYCGKCGLTYVY KA Sbjct: 94 KHKKVKLAILQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >NP_001269170.1 ubiquitin-40S ribosomal protein S27a-like [Cucumis sativus] XP_008446192.1 PREDICTED: ubiquitin-40S ribosomal protein S27a [Cucumis melo] AAQ76040.1 ubiquitin extension protein [Cucumis sativus] ADN33826.1 ubiquitin extension protein [Cucumis melo subsp. melo] Length = 156 Score = 123 bits (308), Expect = 5e-33 Identities = 56/60 (93%), Positives = 57/60 (95%) Frame = -1 Query: 456 KHKKVKLAVLQFYKVDDSGKVARLRKECPNAECGAGTFMASHHDRHYCGKCGLTYVYAKA 277 KHKKVKLAVLQFYKVDDSGKV RLRKECPNAECGAGTFMA+H DRHYCGKCGLTYVY KA Sbjct: 94 KHKKVKLAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKA 153