BLASTX nr result
ID: Alisma22_contig00000761
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00000761 (662 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT54023.1 Antimicrobial peptide 1 [Anthurium amnicola] 80 1e-15 >JAT54023.1 Antimicrobial peptide 1 [Anthurium amnicola] Length = 113 Score = 79.7 bits (195), Expect = 1e-15 Identities = 35/75 (46%), Positives = 45/75 (60%) Frame = +1 Query: 178 YTAIGCNGNSNTYLGCGGCSNLTMFGGYDFVYTGQPLEIYDSYNCQSQYGPSVVTESFRS 357 + IGC GNS + CG C NLT +GGY FVYTGQ Y++YNC G S + E Sbjct: 34 FEVIGCRGNSESVGPCGSCYNLTHYGGYSFVYTGQTAVFYNAYNCDGSNGVSTLNECDAF 93 Query: 358 CGPVKFDRSIRIRCA 402 CG +KF RS+ + C+ Sbjct: 94 CGGLKFYRSVIVGCS 108