BLASTX nr result
ID: Alisma22_contig00000135
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00000135 (655 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ANS56516.1 Metallothionein, partial [Cymodocea nodosa] 95 4e-22 CAA07565.1 metallothionein-like protein [Ribes nigrum] 89 1e-19 ACV51811.1 metallothionein type 3 [Typha angustifolia] 87 3e-19 XP_012084959.1 PREDICTED: metallothionein-like protein type 3 [J... 86 8e-19 OAY54899.1 hypothetical protein MANES_03G110500 [Manihot esculenta] 84 6e-18 XP_020105357.1 metallothionein-like protein type 3 [Ananas comosus] 84 9e-18 KJU81265.1 hypothetical protein N619_00020, partial [Pseudomonas... 84 1e-17 ABA43635.1 metallothionein-like protein [Metroxylon sagu] 81 7e-17 Q40256.1 RecName: Full=Metallothionein-like protein type 3; Shor... 80 1e-16 KQK03196.1 hypothetical protein BRADI_2g06220 [Brachypodium dist... 80 2e-16 ACB10219.2 metallothionein-like protein [Elaeis guineensis] 80 3e-16 ABN46986.1 metallothionein-like protein 3 [Nelumbo nucifera] 79 5e-16 XP_017249272.1 PREDICTED: metallothionein-like protein type 3 [D... 79 7e-16 CAB85630.1 putative metallothionein-like protein [Vitis vinifera... 79 7e-16 CAB52585.1 metallothionein-like protein [Elaeis guineensis] 79 7e-16 KZM99534.1 hypothetical protein DCAR_013104 [Daucus carota subsp... 78 1e-15 EOY13005.1 Metallothionein 3 [Theobroma cacao] 77 2e-15 XP_002525821.1 PREDICTED: metallothionein-like protein type 3 [R... 77 4e-15 XP_013638029.1 PREDICTED: metallothionein-like protein type 3 [B... 77 4e-15 AFP57435.1 putative metallothionein type 3 [Brassica napus] 77 4e-15 >ANS56516.1 Metallothionein, partial [Cymodocea nodosa] Length = 66 Score = 94.7 bits (234), Expect = 4e-22 Identities = 41/64 (64%), Positives = 44/64 (68%) Frame = +3 Query: 66 MSSCGNCDCADKSQCVKKGNNYGFEIVETTKPYHETMEVNMGAENDGKCKCGPNXXXXXX 245 MS+CGNCDCADKSQCVKKGNNYG ++V T K Y ET E E DGKCKCGPN Sbjct: 3 MSTCGNCDCADKSQCVKKGNNYGVQLVVTEKSYFETFEAPAAGETDGKCKCGPNCTCTTC 62 Query: 246 XXGH 257 GH Sbjct: 63 SCGH 66 >CAA07565.1 metallothionein-like protein [Ribes nigrum] Length = 65 Score = 88.6 bits (218), Expect = 1e-19 Identities = 38/65 (58%), Positives = 48/65 (73%), Gaps = 1/65 (1%) Frame = +3 Query: 66 MSSCGNCDCADKSQCVKKGNNYGFEIVETTKPYHETMEVNM-GAENDGKCKCGPNXXXXX 242 MSSCGNCDCADK+ C KKGN+YGF+I+ET K Y + + +++ AENDGKCKCGP+ Sbjct: 1 MSSCGNCDCADKTNCPKKGNSYGFDIIETQKSYDDVVVMDVQAAENDGKCKCGPSCSCVG 60 Query: 243 XXXGH 257 GH Sbjct: 61 CSCGH 65 >ACV51811.1 metallothionein type 3 [Typha angustifolia] Length = 64 Score = 87.4 bits (215), Expect = 3e-19 Identities = 36/54 (66%), Positives = 44/54 (81%) Frame = +3 Query: 66 MSSCGNCDCADKSQCVKKGNNYGFEIVETTKPYHETMEVNMGAENDGKCKCGPN 227 MS+CGNCDCADKSQCVKKGN+YG EI+ET K YH+ + A+N+G CKCGP+ Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGVEIIETEKSYHDGVFEVAAAKNEGNCKCGPS 54 >XP_012084959.1 PREDICTED: metallothionein-like protein type 3 [Jatropha curcas] ADB02892.1 metallothionein-like MT-3 [Jatropha curcas] KDP27057.1 hypothetical protein JCGZ_20992 [Jatropha curcas] Length = 67 Score = 86.3 bits (212), Expect = 8e-19 Identities = 40/65 (61%), Positives = 47/65 (72%), Gaps = 2/65 (3%) Frame = +3 Query: 69 SSCGNCDCADKSQCVKKGNNYGFEIVETTKPYHET--MEVNMGAENDGKCKCGPNXXXXX 242 S+CGNCDCADKSQCVKKG++Y +IVET K + T M+V GAENDGKCKCGP+ Sbjct: 3 STCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVPAGAENDGKCKCGPSCTCVD 62 Query: 243 XXXGH 257 GH Sbjct: 63 CGCGH 67 >OAY54899.1 hypothetical protein MANES_03G110500 [Manihot esculenta] Length = 67 Score = 84.0 bits (206), Expect = 6e-18 Identities = 40/65 (61%), Positives = 45/65 (69%), Gaps = 2/65 (3%) Frame = +3 Query: 69 SSCGNCDCADKSQCVKKGNNYGFEIVETTKPYHET--MEVNMGAENDGKCKCGPNXXXXX 242 S+CGNCDCADKSQCVKKG++Y +IVET K + T MEV AENDGKCKCG N Sbjct: 3 STCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTVVMEVPAAAENDGKCKCGANCTCTT 62 Query: 243 XXXGH 257 GH Sbjct: 63 CTCGH 67 >XP_020105357.1 metallothionein-like protein type 3 [Ananas comosus] Length = 66 Score = 83.6 bits (205), Expect = 9e-18 Identities = 37/52 (71%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = +3 Query: 69 SSCGNCDCADKSQCVKKGNNYGFEIVETTKPYHET-MEVNMGAENDGKCKCG 221 S+CGNCDCADKSQCVKKGN+YG EIVET K Y ++ +E AE+DGKCKCG Sbjct: 3 STCGNCDCADKSQCVKKGNSYGMEIVETEKSYFDSIVEAPAAAEHDGKCKCG 54 >KJU81265.1 hypothetical protein N619_00020, partial [Pseudomonas pseudoalcaligenes] Length = 87 Score = 84.0 bits (206), Expect = 1e-17 Identities = 37/54 (68%), Positives = 46/54 (85%), Gaps = 1/54 (1%) Frame = +3 Query: 69 SSCGNCDCADKSQCVKKGNNYGFEIVETTKPYHETMEVNM-GAENDGKCKCGPN 227 S+CGNCDCADKSQCVKKG++YG +IVET K Y ET+ ++ AE+DGKCKCGP+ Sbjct: 24 STCGNCDCADKSQCVKKGSSYGIDIVETGKSYVETIVMDAPAAEHDGKCKCGPS 77 >ABA43635.1 metallothionein-like protein [Metroxylon sagu] Length = 65 Score = 81.3 bits (199), Expect = 7e-17 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 1/53 (1%) Frame = +3 Query: 66 MSSCGNCDCADKSQCVKKGNNYGFEIVETTKPY-HETMEVNMGAENDGKCKCG 221 MS+CGNCDCADKSQCVKKGN+YG EI+ET K Y +E A+N+G+CKCG Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIEIIETEKSYVDHVVEAPAAAKNEGECKCG 53 >Q40256.1 RecName: Full=Metallothionein-like protein type 3; Short=MT-3; AltName: Full=MWMT3 AAG44759.1 metallothionein-like protein [Musa acuminata] AAQ13534.1 metallothionein-like protein [Musa acuminata AAA Group] AAB82615.1 metallothionein-like protein [Musa acuminata AAA Group] Length = 65 Score = 80.5 bits (197), Expect = 1e-16 Identities = 36/53 (67%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = +3 Query: 66 MSSCGNCDCADKSQCVKKGNNYGFEIVETTKPY-HETMEVNMGAENDGKCKCG 221 MS+CGNCDC DKSQCVKKGN+YG +IVET K Y E + AE+DGKCKCG Sbjct: 1 MSTCGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVAAEAAEHDGKCKCG 53 >KQK03196.1 hypothetical protein BRADI_2g06220 [Brachypodium distachyon] Length = 63 Score = 79.7 bits (195), Expect = 2e-16 Identities = 36/63 (57%), Positives = 41/63 (65%) Frame = +3 Query: 69 SSCGNCDCADKSQCVKKGNNYGFEIVETTKPYHETMEVNMGAENDGKCKCGPNXXXXXXX 248 S CGNCDCADK+QCVKKGN YG +V+T K + E E AENDGKCKCG + Sbjct: 3 SGCGNCDCADKTQCVKKGNGYGIVMVDTEKSHFEVQE--SAAENDGKCKCGTSCTCTSCT 60 Query: 249 XGH 257 GH Sbjct: 61 CGH 63 >ACB10219.2 metallothionein-like protein [Elaeis guineensis] Length = 65 Score = 79.7 bits (195), Expect = 3e-16 Identities = 33/53 (62%), Positives = 43/53 (81%), Gaps = 1/53 (1%) Frame = +3 Query: 66 MSSCGNCDCADKSQCVKKGNNYGFEIVETTKP-YHETMEVNMGAENDGKCKCG 221 MS+CGNCDCADKSQCVKKGN+YG EI+ET K ++ ++ + AE++G CKCG Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIEIIETEKSNFNNVIDASAAAEHEGNCKCG 53 >ABN46986.1 metallothionein-like protein 3 [Nelumbo nucifera] Length = 66 Score = 79.0 bits (193), Expect = 5e-16 Identities = 36/53 (67%), Positives = 40/53 (75%), Gaps = 1/53 (1%) Frame = +3 Query: 66 MSSCGNCDCADKSQCVKKGNNYGFEIVETTKP-YHETMEVNMGAENDGKCKCG 221 MS+CGNCDCADKSQCVKKGN Y EI+ET K Y T+ AE+DGKCKCG Sbjct: 1 MSTCGNCDCADKSQCVKKGNGYTIEIIETEKSFYKNTVSEVPAAEHDGKCKCG 53 >XP_017249272.1 PREDICTED: metallothionein-like protein type 3 [Daucus carota subsp. sativus] Length = 65 Score = 78.6 bits (192), Expect = 7e-16 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = +3 Query: 69 SSCGNCDCADKSQCVKKGNNYGFEIVETTKPYHETMEVNMGAENDGKCKCG 221 ++CGNCDCADK+QCVKKGN++G +IVET K ET+ + G+ENDGKCKCG Sbjct: 3 NTCGNCDCADKTQCVKKGNSFGLDIVETEKISAETIMME-GSENDGKCKCG 52 >CAB85630.1 putative metallothionein-like protein [Vitis vinifera] CBI20304.3 unnamed protein product, partial [Vitis vinifera] Length = 65 Score = 78.6 bits (192), Expect = 7e-16 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 1/53 (1%) Frame = +3 Query: 66 MSSCGNCDCADKSQCVKKGNNYGFEIVETTKPYHETMEVNM-GAENDGKCKCG 221 MS+CGNCDCADKSQCVKKGN+YG +IVET K Y T+ + + A+++G CKCG Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIDIVETEKSYVATVVMEVPAAQHEGSCKCG 53 >CAB52585.1 metallothionein-like protein [Elaeis guineensis] Length = 65 Score = 78.6 bits (192), Expect = 7e-16 Identities = 33/53 (62%), Positives = 42/53 (79%), Gaps = 1/53 (1%) Frame = +3 Query: 66 MSSCGNCDCADKSQCVKKGNNYGFEIVETTKP-YHETMEVNMGAENDGKCKCG 221 MS+CGNCDCADKSQCVKKGN+YG EI+ET K ++ ++ AE++G CKCG Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIEIIETEKSNFNNVIDAPAAAEHEGNCKCG 53 >KZM99534.1 hypothetical protein DCAR_013104 [Daucus carota subsp. sativus] Length = 67 Score = 78.2 bits (191), Expect = 1e-15 Identities = 36/53 (67%), Positives = 43/53 (81%), Gaps = 2/53 (3%) Frame = +3 Query: 69 SSCGNCDCADKSQCVKKGNNYGFEIVETTKPYHET--MEVNMGAENDGKCKCG 221 ++CGNCDC+DKSQCVKKG +YG +IVET K Y +T MEV +ENDGKCKCG Sbjct: 3 NTCGNCDCSDKSQCVKKGTSYGLDIVETGKSYVQTTVMEV-FASENDGKCKCG 54 >EOY13005.1 Metallothionein 3 [Theobroma cacao] Length = 62 Score = 77.4 bits (189), Expect = 2e-15 Identities = 36/61 (59%), Positives = 39/61 (63%) Frame = +3 Query: 75 CGNCDCADKSQCVKKGNNYGFEIVETTKPYHETMEVNMGAENDGKCKCGPNXXXXXXXXG 254 CGNCDCADKSQCVKKGN ++ET K Y T+ V AENDGKCKCG N G Sbjct: 5 CGNCDCADKSQCVKKGNTL---VIETEKSYITTVAVETPAENDGKCKCGANCTCTDCTCG 61 Query: 255 H 257 H Sbjct: 62 H 62 >XP_002525821.1 PREDICTED: metallothionein-like protein type 3 [Ricinus communis] EEF36515.1 conserved hypothetical protein [Ricinus communis] Length = 66 Score = 76.6 bits (187), Expect = 4e-15 Identities = 35/64 (54%), Positives = 46/64 (71%), Gaps = 1/64 (1%) Frame = +3 Query: 69 SSCGNCDCADKSQCVKKGNNYGFEIVETTKPYHETMEVNM-GAENDGKCKCGPNXXXXXX 245 S+CGNCDCADKSQCVKKG++Y +IVET K + T+ +++ AE+DGKCKCG + Sbjct: 3 STCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIIMDVPAAEHDGKCKCGASCTCVTC 62 Query: 246 XXGH 257 GH Sbjct: 63 TCGH 66 >XP_013638029.1 PREDICTED: metallothionein-like protein type 3 [Brassica oleracea var. oleracea] XP_013697693.1 PREDICTED: metallothionein-like protein type 3 [Brassica napus] CDX98551.1 BnaC05g38240D [Brassica napus] Length = 67 Score = 76.6 bits (187), Expect = 4e-15 Identities = 35/54 (64%), Positives = 41/54 (75%), Gaps = 2/54 (3%) Frame = +3 Query: 66 MSSCGNCDCADKSQCVKKGNNYGFEIVETTKPYHET--MEVNMGAENDGKCKCG 221 MSSCGNCDCADK+QCVKKG +Y F+IVET + Y E M+VN EN +CKCG Sbjct: 1 MSSCGNCDCADKTQCVKKGTSYTFDIVETQESYKEAMIMDVNGAEENGCQCKCG 54 >AFP57435.1 putative metallothionein type 3 [Brassica napus] Length = 67 Score = 76.6 bits (187), Expect = 4e-15 Identities = 35/54 (64%), Positives = 41/54 (75%), Gaps = 2/54 (3%) Frame = +3 Query: 66 MSSCGNCDCADKSQCVKKGNNYGFEIVETTKPYHET--MEVNMGAENDGKCKCG 221 MSSCGNCDCADK+QCVKKG +Y F+IVET + Y E M+VN EN +CKCG Sbjct: 1 MSSCGNCDCADKTQCVKKGTSYTFDIVETKESYKEAMIMDVNGAEENGCQCKCG 54