BLASTX nr result
ID: Alisma22_contig00000100
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00000100 (639 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ANS56516.1 Metallothionein, partial [Cymodocea nodosa] 57 1e-07 CAA07565.1 metallothionein-like protein [Ribes nigrum] 56 3e-07 KMZ73458.1 Metallothionein, Plant type 3 [Zostera marina] 53 3e-06 XP_012084959.1 PREDICTED: metallothionein-like protein type 3 [J... 53 4e-06 >ANS56516.1 Metallothionein, partial [Cymodocea nodosa] Length = 66 Score = 57.0 bits (136), Expect = 1e-07 Identities = 23/47 (48%), Positives = 28/47 (59%) Frame = +3 Query: 3 KGNSYGFEIIETAKPYYETMEVSMGAENDGKCKCGPNXXXXXXXXGH 143 KGN+YG +++ T K Y+ET E E DGKCKCGPN GH Sbjct: 20 KGNNYGVQLVVTEKSYFETFEAPAAGETDGKCKCGPNCTCTTCSCGH 66 >CAA07565.1 metallothionein-like protein [Ribes nigrum] Length = 65 Score = 55.8 bits (133), Expect = 3e-07 Identities = 26/48 (54%), Positives = 32/48 (66%), Gaps = 1/48 (2%) Frame = +3 Query: 3 KGNSYGFEIIETAKPYYETMEVSM-GAENDGKCKCGPNXXXXXXXXGH 143 KGNSYGF+IIET K Y + + + + AENDGKCKCGP+ GH Sbjct: 18 KGNSYGFDIIETQKSYDDVVVMDVQAAENDGKCKCGPSCSCVGCSCGH 65 >KMZ73458.1 Metallothionein, Plant type 3 [Zostera marina] Length = 63 Score = 53.1 bits (126), Expect = 3e-06 Identities = 23/47 (48%), Positives = 28/47 (59%) Frame = +3 Query: 3 KGNSYGFEIIETAKPYYETMEVSMGAENDGKCKCGPNXXXXXXXXGH 143 KG+SYGF+++ T YYET E+ G E GKC CGPN GH Sbjct: 18 KGSSYGFDVV-TENSYYETAEIMEGGETGGKCNCGPNCSCTTCGCGH 63 >XP_012084959.1 PREDICTED: metallothionein-like protein type 3 [Jatropha curcas] ADB02892.1 metallothionein-like MT-3 [Jatropha curcas] KDP27057.1 hypothetical protein JCGZ_20992 [Jatropha curcas] Length = 67 Score = 52.8 bits (125), Expect = 4e-06 Identities = 25/49 (51%), Positives = 31/49 (63%), Gaps = 2/49 (4%) Frame = +3 Query: 3 KGNSYGFEIIETAKPYYET--MEVSMGAENDGKCKCGPNXXXXXXXXGH 143 KG+SY +I+ET K + T M+V GAENDGKCKCGP+ GH Sbjct: 19 KGSSYTADIVETEKSFVSTIVMDVPAGAENDGKCKCGPSCTCVDCGCGH 67