BLASTX nr result
ID: Alisma22_contig00000086
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00000086 (745 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KMZ73458.1 Metallothionein, Plant type 3 [Zostera marina] 53 6e-06 >KMZ73458.1 Metallothionein, Plant type 3 [Zostera marina] Length = 63 Score = 52.8 bits (125), Expect = 6e-06 Identities = 23/47 (48%), Positives = 29/47 (61%) Frame = -2 Query: 687 EQGNSYGFEVETAKPYHETMEVNMGAENDGKCKCGPNXXXXXXXCGH 547 ++G+SYGF+V T Y+ET E+ G E GKC CGPN CGH Sbjct: 17 KKGSSYGFDVVTENSYYETAEIMEGGETGGKCNCGPNCSCTTCGCGH 63