BLASTX nr result
ID: Alisma22_contig00000085
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00000085 (322 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EEF36719.1 conserved hypothetical protein [Ricinus communis] 52 2e-06 >EEF36719.1 conserved hypothetical protein [Ricinus communis] Length = 110 Score = 52.0 bits (123), Expect = 2e-06 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = +1 Query: 172 HPCARQTRKKNKCTLPPQALSCSGTKGLSQPVLL 273 HP Q + K KCTLP QALSCSG+KGLSQP LL Sbjct: 22 HPVQEQKKWKRKCTLPTQALSCSGSKGLSQPDLL 55