BLASTX nr result
ID: Akebia27_contig00045296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00045296 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMR61551.1| putative integral membrane protein [Eutypa lata U... 94 2e-17 gb|ETS86744.1| hypothetical protein PFICI_00572 [Pestalotiopsis ... 91 1e-16 ref|XP_007594829.1| hypothetical protein CFIO01_03013 [Colletotr... 89 8e-16 gb|EJP66480.1| mitochondrial integral membrane protein [Beauveri... 89 8e-16 ref|XP_006672241.1| integral membrane protein [Cordyceps militar... 89 8e-16 ref|XP_003659562.1| hypothetical protein MYCTH_2296776 [Myceliop... 88 1e-15 gb|EQB44750.1| hypothetical protein CGLO_16465 [Colletotrichum g... 87 3e-15 ref|XP_007284508.1| integral membrane protein [Colletotrichum gl... 87 3e-15 emb|CCF34473.1| mitochondrial integral membrane protein, partial... 87 3e-15 ref|XP_001229337.1| hypothetical protein CHGG_02821 [Chaetomium ... 86 5e-15 gb|ELQ33219.1| integral membrane protein [Magnaporthe oryzae Y34... 86 7e-15 ref|XP_003713493.1| integral membrane protein [Magnaporthe oryza... 86 7e-15 gb|EAA36227.2| mitochondrial integral membrane protein [Neurospo... 85 9e-15 gb|EGZ77806.1| hypothetical protein NEUTE2DRAFT_162544 [Neurospo... 85 9e-15 emb|CCE33111.1| uncharacterized protein CPUR_07034 [Claviceps pu... 85 1e-14 ref|XP_003053426.1| hypothetical protein NECHADRAFT_103079 [Nect... 85 1e-14 gb|ENH88344.1| integral membrane protein [Colletotrichum orbicul... 84 2e-14 ref|XP_003651662.1| hypothetical protein THITE_2076548 [Thielavi... 84 2e-14 ref|XP_003351044.1| hypothetical protein SMAC_04348 [Sordaria ma... 84 2e-14 gb|EGY22759.1| mitochondrial integral membrane protein [Verticil... 83 3e-14 >gb|EMR61551.1| putative integral membrane protein [Eutypa lata UCREL1] Length = 531 Score = 94.0 bits (232), Expect = 2e-17 Identities = 45/58 (77%), Positives = 51/58 (87%), Gaps = 5/58 (8%) Frame = -3 Query: 162 RAPNEHTRLLPNRVESSN-----NYLSPDDPAVSPYNLWSVRIVRWLTVLLTLITFIW 4 RAP+E+TRLLPNRVESSN +YLSPDDPAVSPYNLWSVRIVR+LT+L L+TFIW Sbjct: 29 RAPDEYTRLLPNRVESSNPLEGNSYLSPDDPAVSPYNLWSVRIVRYLTILFALLTFIW 86 >gb|ETS86744.1| hypothetical protein PFICI_00572 [Pestalotiopsis fici W106-1] Length = 528 Score = 91.3 bits (225), Expect = 1e-16 Identities = 46/81 (56%), Positives = 56/81 (69%), Gaps = 4/81 (4%) Frame = -3 Query: 234 LWGSKKNXXXXXXXXXXXXXXXXG----RAPNEHTRLLPNRVESSNNYLSPDDPAVSPYN 67 LWG+KK+ RAP+EHTRLLPNR+ES++ YLSPDDPAVSPYN Sbjct: 5 LWGTKKDQDDEDHRNGAGGAARDSEDMDRAPDEHTRLLPNRLESTH-YLSPDDPAVSPYN 63 Query: 66 LWSVRIVRWLTVLLTLITFIW 4 LWSVR +R+LT+ LTL TF+W Sbjct: 64 LWSVRFLRYLTIFLTLATFVW 84 >ref|XP_007594829.1| hypothetical protein CFIO01_03013 [Colletotrichum fioriniae PJ7] gi|588901020|gb|EXF81554.1| hypothetical protein CFIO01_03013 [Colletotrichum fioriniae PJ7] Length = 537 Score = 88.6 bits (218), Expect = 8e-16 Identities = 38/54 (70%), Positives = 47/54 (87%), Gaps = 1/54 (1%) Frame = -3 Query: 162 RAPNEHTRLLPNRVESSNN-YLSPDDPAVSPYNLWSVRIVRWLTVLLTLITFIW 4 R P+EHTRLLPNR++S N YL+PDDPAVSPYNLW+VR++RW+TVL T +TF W Sbjct: 35 REPDEHTRLLPNRLDSDNRQYLTPDDPAVSPYNLWTVRVLRWVTVLFTALTFTW 88 >gb|EJP66480.1| mitochondrial integral membrane protein [Beauveria bassiana ARSEF 2860] Length = 526 Score = 88.6 bits (218), Expect = 8e-16 Identities = 36/51 (70%), Positives = 46/51 (90%) Frame = -3 Query: 156 PNEHTRLLPNRVESSNNYLSPDDPAVSPYNLWSVRIVRWLTVLLTLITFIW 4 P+EHTRLLPNRV+SS L+PDDPAV+PYNLWS+R++RW+TV++TL TF W Sbjct: 29 PDEHTRLLPNRVDSSRGMLTPDDPAVTPYNLWSIRLLRWVTVVVTLATFFW 79 >ref|XP_006672241.1| integral membrane protein [Cordyceps militaris CM01] gi|346321020|gb|EGX90620.1| integral membrane protein [Cordyceps militaris CM01] Length = 525 Score = 88.6 bits (218), Expect = 8e-16 Identities = 36/51 (70%), Positives = 45/51 (88%) Frame = -3 Query: 156 PNEHTRLLPNRVESSNNYLSPDDPAVSPYNLWSVRIVRWLTVLLTLITFIW 4 P+EHTRLLPNRV+SS L+PDDPAV+PYNLWS+R++RW TV+L L+TF W Sbjct: 28 PDEHTRLLPNRVDSSRGMLTPDDPAVTPYNLWSIRLLRWATVVLALVTFFW 78 >ref|XP_003659562.1| hypothetical protein MYCTH_2296776 [Myceliophthora thermophila ATCC 42464] gi|347006829|gb|AEO54317.1| hypothetical protein MYCTH_2296776 [Myceliophthora thermophila ATCC 42464] Length = 493 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = -3 Query: 156 PNEHTRLLPNRVESSNNYLSPDDPAVSPYNLWSVRIVRWLTVLLTLITFIW 4 P+EHTRLLPNRV+S+ YLSPDDPAVSPYNLW+VR+VRW+TV LT +TF W Sbjct: 28 PDEHTRLLPNRVDSTP-YLSPDDPAVSPYNLWTVRLVRWITVALTCVTFAW 77 >gb|EQB44750.1| hypothetical protein CGLO_16465 [Colletotrichum gloeosporioides Cg-14] Length = 531 Score = 86.7 bits (213), Expect = 3e-15 Identities = 37/54 (68%), Positives = 46/54 (85%), Gaps = 1/54 (1%) Frame = -3 Query: 162 RAPNEHTRLLPNRVESSNN-YLSPDDPAVSPYNLWSVRIVRWLTVLLTLITFIW 4 R P+EHTRLLPNR++S N +L+PDDPAVSPYNLW+VR++RW TVL +TFIW Sbjct: 33 REPDEHTRLLPNRLDSDNRQFLTPDDPAVSPYNLWTVRVMRWATVLFACVTFIW 86 >ref|XP_007284508.1| integral membrane protein [Colletotrichum gloeosporioides Nara gc5] gi|429851225|gb|ELA26434.1| integral membrane protein [Colletotrichum gloeosporioides Nara gc5] Length = 531 Score = 86.7 bits (213), Expect = 3e-15 Identities = 37/54 (68%), Positives = 46/54 (85%), Gaps = 1/54 (1%) Frame = -3 Query: 162 RAPNEHTRLLPNRVESSNN-YLSPDDPAVSPYNLWSVRIVRWLTVLLTLITFIW 4 R P+EHTRLLPNR++S N +L+PDDPAVSPYNLW+VR++RW TVL +TFIW Sbjct: 33 REPDEHTRLLPNRLDSDNRQFLTPDDPAVSPYNLWTVRVMRWATVLFACVTFIW 86 >emb|CCF34473.1| mitochondrial integral membrane protein, partial [Colletotrichum higginsianum] Length = 247 Score = 86.7 bits (213), Expect = 3e-15 Identities = 37/54 (68%), Positives = 46/54 (85%), Gaps = 1/54 (1%) Frame = -3 Query: 162 RAPNEHTRLLPNRVESSNN-YLSPDDPAVSPYNLWSVRIVRWLTVLLTLITFIW 4 R P+EHTRLLPNR++S N +L+PDDPAVSPYNLW+VR++RW TVL T +TF W Sbjct: 32 RGPDEHTRLLPNRLDSDNRQFLTPDDPAVSPYNLWTVRVMRWATVLFTALTFTW 85 >ref|XP_001229337.1| hypothetical protein CHGG_02821 [Chaetomium globosum CBS 148.51] gi|88183418|gb|EAQ90886.1| hypothetical protein CHGG_02821 [Chaetomium globosum CBS 148.51] Length = 527 Score = 85.9 bits (211), Expect = 5e-15 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = -3 Query: 153 NEHTRLLPNRVESSNNYLSPDDPAVSPYNLWSVRIVRWLTVLLTLITFIW 4 +EHTRLLPNR+ S+ YLSPDDPAVSPYNLW+VR VRW+TV LT+ITF+W Sbjct: 35 DEHTRLLPNRIHSTP-YLSPDDPAVSPYNLWTVRFVRWITVALTVITFVW 83 >gb|ELQ33219.1| integral membrane protein [Magnaporthe oryzae Y34] gi|440481916|gb|ELQ62452.1| integral membrane protein [Magnaporthe oryzae P131] Length = 522 Score = 85.5 bits (210), Expect = 7e-15 Identities = 36/55 (65%), Positives = 50/55 (90%), Gaps = 2/55 (3%) Frame = -3 Query: 162 RAPNEHTRLLPNRVES--SNNYLSPDDPAVSPYNLWSVRIVRWLTVLLTLITFIW 4 RAP+E+TRLLPNR++S + YLSPDDPAV+PYNLWSVR++RW+TV+ T+++F+W Sbjct: 26 RAPDEYTRLLPNRLDSDATPRYLSPDDPAVTPYNLWSVRLMRWVTVIFTMLSFMW 80 >ref|XP_003713493.1| integral membrane protein [Magnaporthe oryzae 70-15] gi|351645826|gb|EHA53686.1| integral membrane protein [Magnaporthe oryzae 70-15] Length = 522 Score = 85.5 bits (210), Expect = 7e-15 Identities = 36/55 (65%), Positives = 50/55 (90%), Gaps = 2/55 (3%) Frame = -3 Query: 162 RAPNEHTRLLPNRVES--SNNYLSPDDPAVSPYNLWSVRIVRWLTVLLTLITFIW 4 RAP+E+TRLLPNR++S + YLSPDDPAV+PYNLWSVR++RW+TV+ T+++F+W Sbjct: 26 RAPDEYTRLLPNRLDSDATPRYLSPDDPAVTPYNLWSVRLMRWVTVIFTMLSFMW 80 >gb|EAA36227.2| mitochondrial integral membrane protein [Neurospora crassa OR74A] Length = 533 Score = 85.1 bits (209), Expect = 9e-15 Identities = 38/52 (73%), Positives = 48/52 (92%), Gaps = 1/52 (1%) Frame = -3 Query: 156 PNEHTRLLPNRVESSN-NYLSPDDPAVSPYNLWSVRIVRWLTVLLTLITFIW 4 P+EHTRLLPNRV+S++ +YLSPDDPAVSPYNLW+VR+VR +TV+ T +TFIW Sbjct: 37 PDEHTRLLPNRVDSTSISYLSPDDPAVSPYNLWTVRLVRAITVIFTCLTFIW 88 >gb|EGZ77806.1| hypothetical protein NEUTE2DRAFT_162544 [Neurospora tetrasperma FGSC 2509] Length = 590 Score = 85.1 bits (209), Expect = 9e-15 Identities = 38/52 (73%), Positives = 48/52 (92%), Gaps = 1/52 (1%) Frame = -3 Query: 156 PNEHTRLLPNRVESSN-NYLSPDDPAVSPYNLWSVRIVRWLTVLLTLITFIW 4 P+EHTRLLPNRV+S++ +YLSPDDPAVSPYNLW+VR+VR +TV+ T +TFIW Sbjct: 37 PDEHTRLLPNRVDSTSISYLSPDDPAVSPYNLWTVRLVRAITVIFTCLTFIW 88 >emb|CCE33111.1| uncharacterized protein CPUR_07034 [Claviceps purpurea 20.1] Length = 531 Score = 84.7 bits (208), Expect = 1e-14 Identities = 37/55 (67%), Positives = 46/55 (83%), Gaps = 4/55 (7%) Frame = -3 Query: 156 PNEHTRLLPNRVESSNN----YLSPDDPAVSPYNLWSVRIVRWLTVLLTLITFIW 4 P+EHTRLLPNRV+SS L+PDDPAV+PYNLWS+RI+RWLT+L +ITF+W Sbjct: 31 PDEHTRLLPNRVDSSRESARVLLAPDDPAVTPYNLWSIRILRWLTLLFAIITFVW 85 >ref|XP_003053426.1| hypothetical protein NECHADRAFT_103079 [Nectria haematococca mpVI 77-13-4] gi|256734367|gb|EEU47713.1| hypothetical protein NECHADRAFT_103079 [Nectria haematococca mpVI 77-13-4] Length = 520 Score = 84.7 bits (208), Expect = 1e-14 Identities = 35/52 (67%), Positives = 45/52 (86%) Frame = -3 Query: 159 APNEHTRLLPNRVESSNNYLSPDDPAVSPYNLWSVRIVRWLTVLLTLITFIW 4 AP+EHTRLLPNRV+S L+PDDPAV+PYNLWS+R +R+L++L TLIT +W Sbjct: 24 APDEHTRLLPNRVDSGRGLLAPDDPAVTPYNLWSIRALRYLSILFTLITLVW 75 >gb|ENH88344.1| integral membrane protein [Colletotrichum orbiculare MAFF 240422] Length = 530 Score = 84.3 bits (207), Expect = 2e-14 Identities = 37/54 (68%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -3 Query: 162 RAPNEHTRLLPNRVESSNNYL-SPDDPAVSPYNLWSVRIVRWLTVLLTLITFIW 4 R P+EHTRLLPNR++ N L +PDDPAVSPYNLW+VRI+RW+TVL +TFIW Sbjct: 32 REPDEHTRLLPNRLDGDNRQLLTPDDPAVSPYNLWTVRIMRWVTVLFAALTFIW 85 >ref|XP_003651662.1| hypothetical protein THITE_2076548 [Thielavia terrestris NRRL 8126] gi|346998924|gb|AEO65326.1| hypothetical protein THITE_2076548 [Thielavia terrestris NRRL 8126] Length = 535 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = -3 Query: 156 PNEHTRLLPNRVESSNNYLSPDDPAVSPYNLWSVRIVRWLTVLLTLITFIW 4 P+EHTRLLPNRV+ + YLSPDDPAVSPYNLW+VR+VRW+TV LT I F W Sbjct: 34 PDEHTRLLPNRVDGTP-YLSPDDPAVSPYNLWTVRLVRWVTVALTCIAFAW 83 >ref|XP_003351044.1| hypothetical protein SMAC_04348 [Sordaria macrospora k-hell] gi|380090811|emb|CCC04981.1| unnamed protein product [Sordaria macrospora k-hell] Length = 529 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 1/52 (1%) Frame = -3 Query: 156 PNEHTRLLPNRVESSN-NYLSPDDPAVSPYNLWSVRIVRWLTVLLTLITFIW 4 P+EHTRLLPNRV+S+ YLSPDDPAVSPYNLW+VR+VR +TV+LT +TFIW Sbjct: 33 PDEHTRLLPNRVDSTGIPYLSPDDPAVSPYNLWTVRLVRAVTVVLTCLTFIW 84 >gb|EGY22759.1| mitochondrial integral membrane protein [Verticillium dahliae VdLs.17] Length = 534 Score = 83.2 bits (204), Expect = 3e-14 Identities = 35/52 (67%), Positives = 44/52 (84%) Frame = -3 Query: 159 APNEHTRLLPNRVESSNNYLSPDDPAVSPYNLWSVRIVRWLTVLLTLITFIW 4 APNEHTRLLPNR++S +L+ DDPAVSPYNLW+VR+ R+ TVL +I+FIW Sbjct: 37 APNEHTRLLPNRLDSDRPFLTADDPAVSPYNLWAVRVTRYATVLFAIISFIW 88