BLASTX nr result
ID: Akebia27_contig00045287
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00045287 (414 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS29524.1| hypothetical protein PDE_04474 [Penicillium oxali... 56 5e-06 ref|XP_003853820.1| hypothetical protein MYCGRDRAFT_69789 [Zymos... 56 6e-06 >gb|EPS29524.1| hypothetical protein PDE_04474 [Penicillium oxalicum 114-2] Length = 320 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/60 (45%), Positives = 34/60 (56%) Frame = -2 Query: 395 RCGPETALTPDSDPVLESICITDDCEQAANATCDAYDSVIVPGIANDTLAMGIGNASSTA 216 RC PE + P +S C C A NATC AY+ V P +AN TLAMG G+ SS++ Sbjct: 212 RCAPEVTVIKAQGPQWQSTCTDSSCPLADNATCSAYEMVPQPAVANATLAMGEGSNSSSS 271 >ref|XP_003853820.1| hypothetical protein MYCGRDRAFT_69789 [Zymoseptoria tritici IPO323] gi|339473703|gb|EGP88796.1| hypothetical protein MYCGRDRAFT_69789 [Zymoseptoria tritici IPO323] Length = 307 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/61 (40%), Positives = 36/61 (59%) Frame = -2 Query: 395 RCGPETALTPDSDPVLESICITDDCEQAANATCDAYDSVIVPGIANDTLAMGIGNASSTA 216 RC P A+ P ++P L++IC +DC + NATCDAY +V+ P A + G + TA Sbjct: 210 RCAPAAAVLPKAEPELQAICQAEDCPISPNATCDAYPAVMKPAEATSPASGGNSSMDGTA 269 Query: 215 T 213 T Sbjct: 270 T 270