BLASTX nr result
ID: Akebia27_contig00045173
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00045173 (424 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB68664.1| hypothetical protein L484_024678 [Morus notabilis] 134 1e-29 ref|XP_004292932.1| PREDICTED: pentatricopeptide repeat-containi... 133 3e-29 ref|XP_007017888.1| Pentatricopeptide repeat (PPR) superfamily p... 131 1e-28 ref|XP_007227203.1| hypothetical protein PRUPE_ppa019251mg [Prun... 129 5e-28 emb|CBI18929.3| unnamed protein product [Vitis vinifera] 127 2e-27 ref|XP_002284744.1| PREDICTED: pentatricopeptide repeat-containi... 127 2e-27 ref|NP_173449.1| pentatricopeptide repeat-containing protein [Ar... 124 1e-26 ref|XP_002890375.1| pentatricopeptide repeat-containing protein ... 124 1e-26 ref|XP_006306841.1| hypothetical protein CARUB_v10008385mg [Caps... 124 2e-26 ref|XP_004250454.1| PREDICTED: pentatricopeptide repeat-containi... 124 2e-26 ref|XP_006416418.1| hypothetical protein EUTSA_v10009574mg [Eutr... 123 2e-26 gb|EYU24286.1| hypothetical protein MIMGU_mgv1a025107mg [Mimulus... 122 4e-26 gb|EMS48015.1| hypothetical protein TRIUR3_15376 [Triticum urartu] 121 1e-25 gb|EPS74339.1| hypothetical protein M569_00411 [Genlisea aurea] 120 1e-25 gb|EYU18955.1| hypothetical protein MIMGU_mgv1a022111mg [Mimulus... 120 2e-25 ref|XP_003549191.1| PREDICTED: pentatricopeptide repeat-containi... 120 2e-25 ref|XP_003566320.1| PREDICTED: pentatricopeptide repeat-containi... 119 4e-25 gb|EEC84350.1| hypothetical protein OsI_30872 [Oryza sativa Indi... 119 6e-25 ref|XP_002301973.2| pentatricopeptide repeat-containing family p... 118 7e-25 ref|XP_006587447.1| PREDICTED: pentatricopeptide repeat-containi... 118 1e-24 >gb|EXB68664.1| hypothetical protein L484_024678 [Morus notabilis] Length = 728 Score = 134 bits (338), Expect = 1e-29 Identities = 60/67 (89%), Positives = 63/67 (94%) Frame = +1 Query: 1 EKLAIGLGLLNTPPGSSLRIIKNLRICGDCHVVIKFISNFEGREIFVRDTNRFHHFKDGV 180 EKLA+ GLLNTPPGSSLR+IKNLRICGDCHVVIKFIS+FE REIFVRDTNRFHHFKDG Sbjct: 662 EKLAVAFGLLNTPPGSSLRVIKNLRICGDCHVVIKFISSFEQREIFVRDTNRFHHFKDGH 721 Query: 181 CSCGDYW 201 CSCGDYW Sbjct: 722 CSCGDYW 728 >ref|XP_004292932.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Fragaria vesca subsp. vesca] Length = 755 Score = 133 bits (334), Expect = 3e-29 Identities = 60/67 (89%), Positives = 63/67 (94%) Frame = +1 Query: 1 EKLAIGLGLLNTPPGSSLRIIKNLRICGDCHVVIKFISNFEGREIFVRDTNRFHHFKDGV 180 EKLA+ LGLLNTPPGSSLR+IKNLRICGDCH VIKFIS+ EGREI VRDTNRFHHFKDGV Sbjct: 689 EKLAVVLGLLNTPPGSSLRVIKNLRICGDCHSVIKFISSLEGREISVRDTNRFHHFKDGV 748 Query: 181 CSCGDYW 201 CSCGDYW Sbjct: 749 CSCGDYW 755 >ref|XP_007017888.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508723216|gb|EOY15113.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 758 Score = 131 bits (329), Expect = 1e-28 Identities = 58/67 (86%), Positives = 61/67 (91%) Frame = +1 Query: 1 EKLAIGLGLLNTPPGSSLRIIKNLRICGDCHVVIKFISNFEGREIFVRDTNRFHHFKDGV 180 EKLA+ GLLNTPPGS L+IIKNLRICGDCH VIKFIS FEGREI+VRDTNRFHHFKDGV Sbjct: 692 EKLAVAFGLLNTPPGSPLQIIKNLRICGDCHAVIKFISGFEGREIYVRDTNRFHHFKDGV 751 Query: 181 CSCGDYW 201 CSC DYW Sbjct: 752 CSCRDYW 758 >ref|XP_007227203.1| hypothetical protein PRUPE_ppa019251mg [Prunus persica] gi|462424139|gb|EMJ28402.1| hypothetical protein PRUPE_ppa019251mg [Prunus persica] Length = 654 Score = 129 bits (323), Expect = 5e-28 Identities = 58/67 (86%), Positives = 62/67 (92%) Frame = +1 Query: 1 EKLAIGLGLLNTPPGSSLRIIKNLRICGDCHVVIKFISNFEGREIFVRDTNRFHHFKDGV 180 EKLA+ LGLLN+PPGSSLR+IKNLRICGDCH VIKFIS+FEGREI VRDTN FHHFKDGV Sbjct: 588 EKLAVVLGLLNSPPGSSLRVIKNLRICGDCHAVIKFISSFEGREISVRDTNLFHHFKDGV 647 Query: 181 CSCGDYW 201 CSC DYW Sbjct: 648 CSCEDYW 654 >emb|CBI18929.3| unnamed protein product [Vitis vinifera] Length = 387 Score = 127 bits (319), Expect = 2e-27 Identities = 56/67 (83%), Positives = 61/67 (91%) Frame = +1 Query: 1 EKLAIGLGLLNTPPGSSLRIIKNLRICGDCHVVIKFISNFEGREIFVRDTNRFHHFKDGV 180 EKLA+ GLLNTPPG L++IKNLRICGDCHVVIKFIS+FE REIFVRDTNRFHHFK+G Sbjct: 321 EKLAVVFGLLNTPPGYPLQVIKNLRICGDCHVVIKFISSFERREIFVRDTNRFHHFKEGA 380 Query: 181 CSCGDYW 201 CSCGDYW Sbjct: 381 CSCGDYW 387 >ref|XP_002284744.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 [Vitis vinifera] Length = 758 Score = 127 bits (319), Expect = 2e-27 Identities = 56/67 (83%), Positives = 61/67 (91%) Frame = +1 Query: 1 EKLAIGLGLLNTPPGSSLRIIKNLRICGDCHVVIKFISNFEGREIFVRDTNRFHHFKDGV 180 EKLA+ GLLNTPPG L++IKNLRICGDCHVVIKFIS+FE REIFVRDTNRFHHFK+G Sbjct: 692 EKLAVVFGLLNTPPGYPLQVIKNLRICGDCHVVIKFISSFERREIFVRDTNRFHHFKEGA 751 Query: 181 CSCGDYW 201 CSCGDYW Sbjct: 752 CSCGDYW 758 >ref|NP_173449.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806503|sp|Q9LNU6.2|PPR53_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g20230 gi|332191832|gb|AEE29953.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 760 Score = 124 bits (311), Expect = 1e-26 Identities = 52/67 (77%), Positives = 61/67 (91%) Frame = +1 Query: 1 EKLAIGLGLLNTPPGSSLRIIKNLRICGDCHVVIKFISNFEGREIFVRDTNRFHHFKDGV 180 EKLA+ GLLNTP G+ L++IKNLRICGDCH VIKFIS++ GREIF+RDTNRFHHFKDG+ Sbjct: 694 EKLAVVFGLLNTPDGTPLQVIKNLRICGDCHAVIKFISSYAGREIFIRDTNRFHHFKDGI 753 Query: 181 CSCGDYW 201 CSCGD+W Sbjct: 754 CSCGDFW 760 >ref|XP_002890375.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297336217|gb|EFH66634.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 760 Score = 124 bits (311), Expect = 1e-26 Identities = 52/67 (77%), Positives = 61/67 (91%) Frame = +1 Query: 1 EKLAIGLGLLNTPPGSSLRIIKNLRICGDCHVVIKFISNFEGREIFVRDTNRFHHFKDGV 180 EKLA+ GLLNTP G+ L++IKNLRICGDCH VIKFIS++ GREIF+RDTNRFHHFKDG+ Sbjct: 694 EKLAVVFGLLNTPDGTPLQVIKNLRICGDCHAVIKFISSYAGREIFIRDTNRFHHFKDGI 753 Query: 181 CSCGDYW 201 CSCGD+W Sbjct: 754 CSCGDFW 760 >ref|XP_006306841.1| hypothetical protein CARUB_v10008385mg [Capsella rubella] gi|482575552|gb|EOA39739.1| hypothetical protein CARUB_v10008385mg [Capsella rubella] Length = 760 Score = 124 bits (310), Expect = 2e-26 Identities = 53/67 (79%), Positives = 61/67 (91%) Frame = +1 Query: 1 EKLAIGLGLLNTPPGSSLRIIKNLRICGDCHVVIKFISNFEGREIFVRDTNRFHHFKDGV 180 EKLA+ GLLNTP G+ L++IKNLRICGDCH VIKFIS++ GREIFVRDTNRFHHFKDG+ Sbjct: 694 EKLAVVFGLLNTPDGTPLQVIKNLRICGDCHSVIKFISSYAGREIFVRDTNRFHHFKDGI 753 Query: 181 CSCGDYW 201 CSCGD+W Sbjct: 754 CSCGDFW 760 >ref|XP_004250454.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Solanum lycopersicum] Length = 828 Score = 124 bits (310), Expect = 2e-26 Identities = 52/67 (77%), Positives = 61/67 (91%) Frame = +1 Query: 1 EKLAIGLGLLNTPPGSSLRIIKNLRICGDCHVVIKFISNFEGREIFVRDTNRFHHFKDGV 180 EKLA+ LG+LNT PG+SLR+IKNLRICGDCH IKFIS+FEGREI+VRD NR+HHF +G+ Sbjct: 762 EKLAVVLGILNTNPGTSLRVIKNLRICGDCHTFIKFISSFEGREIYVRDANRYHHFNEGI 821 Query: 181 CSCGDYW 201 CSCGDYW Sbjct: 822 CSCGDYW 828 >ref|XP_006416418.1| hypothetical protein EUTSA_v10009574mg [Eutrema salsugineum] gi|557094189|gb|ESQ34771.1| hypothetical protein EUTSA_v10009574mg [Eutrema salsugineum] Length = 760 Score = 123 bits (309), Expect = 2e-26 Identities = 53/67 (79%), Positives = 60/67 (89%) Frame = +1 Query: 1 EKLAIGLGLLNTPPGSSLRIIKNLRICGDCHVVIKFISNFEGREIFVRDTNRFHHFKDGV 180 EKLA+ GLLNTP G+ L++IKNLRICGDCH VIKFIS + GREIFVRDTNRFHHFKDG+ Sbjct: 694 EKLAVVFGLLNTPDGTPLQVIKNLRICGDCHSVIKFISGYAGREIFVRDTNRFHHFKDGI 753 Query: 181 CSCGDYW 201 CSCGD+W Sbjct: 754 CSCGDFW 760 >gb|EYU24286.1| hypothetical protein MIMGU_mgv1a025107mg [Mimulus guttatus] Length = 654 Score = 122 bits (307), Expect = 4e-26 Identities = 54/67 (80%), Positives = 58/67 (86%) Frame = +1 Query: 1 EKLAIGLGLLNTPPGSSLRIIKNLRICGDCHVVIKFISNFEGREIFVRDTNRFHHFKDGV 180 EKLA+ G+LNT PGS LR+ KNLRICGDCH VIKFIS FE REIFVRDTNR+HHFKDG Sbjct: 588 EKLAVVFGILNTSPGSPLRVTKNLRICGDCHAVIKFISRFERREIFVRDTNRYHHFKDGD 647 Query: 181 CSCGDYW 201 CSCGDYW Sbjct: 648 CSCGDYW 654 >gb|EMS48015.1| hypothetical protein TRIUR3_15376 [Triticum urartu] Length = 662 Score = 121 bits (303), Expect = 1e-25 Identities = 53/67 (79%), Positives = 59/67 (88%) Frame = +1 Query: 1 EKLAIGLGLLNTPPGSSLRIIKNLRICGDCHVVIKFISNFEGREIFVRDTNRFHHFKDGV 180 EKLA+ LGL++T PG+ LR+IKNLRICGDCH +KFIS FEGREI VRDTNRFHHFKDG Sbjct: 596 EKLAVALGLISTSPGTPLRVIKNLRICGDCHEAMKFISCFEGREISVRDTNRFHHFKDGK 655 Query: 181 CSCGDYW 201 CSCGDYW Sbjct: 656 CSCGDYW 662 >gb|EPS74339.1| hypothetical protein M569_00411 [Genlisea aurea] Length = 1063 Score = 120 bits (302), Expect = 1e-25 Identities = 52/67 (77%), Positives = 58/67 (86%) Frame = +1 Query: 1 EKLAIGLGLLNTPPGSSLRIIKNLRICGDCHVVIKFISNFEGREIFVRDTNRFHHFKDGV 180 EKLA+ G+LNT GS +R+ KNLRICGDCH VIKFIS FEGREI VRDTNR+HHFKDG+ Sbjct: 997 EKLAVVFGILNTSRGSPIRVTKNLRICGDCHAVIKFISGFEGREISVRDTNRYHHFKDGI 1056 Query: 181 CSCGDYW 201 CSCGDYW Sbjct: 1057 CSCGDYW 1063 >gb|EYU18955.1| hypothetical protein MIMGU_mgv1a022111mg [Mimulus guttatus] Length = 654 Score = 120 bits (301), Expect = 2e-25 Identities = 53/67 (79%), Positives = 57/67 (85%) Frame = +1 Query: 1 EKLAIGLGLLNTPPGSSLRIIKNLRICGDCHVVIKFISNFEGREIFVRDTNRFHHFKDGV 180 EKLA+ G+LN PGS LR+ KNLRICGDCH VIKFIS FE REIFVRDTNR+HHFKDG Sbjct: 588 EKLAVVFGILNMSPGSPLRVTKNLRICGDCHAVIKFISRFERREIFVRDTNRYHHFKDGD 647 Query: 181 CSCGDYW 201 CSCGDYW Sbjct: 648 CSCGDYW 654 >ref|XP_003549191.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like isoform X1 [Glycine max] Length = 748 Score = 120 bits (301), Expect = 2e-25 Identities = 53/67 (79%), Positives = 58/67 (86%) Frame = +1 Query: 1 EKLAIGLGLLNTPPGSSLRIIKNLRICGDCHVVIKFISNFEGREIFVRDTNRFHHFKDGV 180 EKLA+ LGLLNT PG L++IKNLRIC DCH VIK IS EGREI+VRDTNRFHHFKDGV Sbjct: 682 EKLAVVLGLLNTSPGQPLQVIKNLRICDDCHAVIKVISRLEGREIYVRDTNRFHHFKDGV 741 Query: 181 CSCGDYW 201 CSCGD+W Sbjct: 742 CSCGDFW 748 >ref|XP_003566320.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Brachypodium distachyon] Length = 661 Score = 119 bits (298), Expect = 4e-25 Identities = 52/67 (77%), Positives = 59/67 (88%) Frame = +1 Query: 1 EKLAIGLGLLNTPPGSSLRIIKNLRICGDCHVVIKFISNFEGREIFVRDTNRFHHFKDGV 180 EKLA+ LGL++T PG+ LR+IKNLRICGDCH +KFIS+FE REI VRDTNRFHHFKDG Sbjct: 595 EKLAVALGLISTRPGTPLRVIKNLRICGDCHEAMKFISSFEQREISVRDTNRFHHFKDGK 654 Query: 181 CSCGDYW 201 CSCGDYW Sbjct: 655 CSCGDYW 661 >gb|EEC84350.1| hypothetical protein OsI_30872 [Oryza sativa Indica Group] Length = 122 Score = 119 bits (297), Expect = 6e-25 Identities = 51/67 (76%), Positives = 59/67 (88%) Frame = +1 Query: 1 EKLAIGLGLLNTPPGSSLRIIKNLRICGDCHVVIKFISNFEGREIFVRDTNRFHHFKDGV 180 EKLA+ LGL++T G+ LR+IKNLRICGDCH +KFIS+FEGREI+VRDTNRFHHFKDG Sbjct: 56 EKLAVALGLISTSRGTPLRVIKNLRICGDCHEAMKFISSFEGREIYVRDTNRFHHFKDGK 115 Query: 181 CSCGDYW 201 CSC DYW Sbjct: 116 CSCADYW 122 >ref|XP_002301973.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550344115|gb|EEE81246.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 724 Score = 118 bits (296), Expect = 7e-25 Identities = 54/67 (80%), Positives = 58/67 (86%) Frame = +1 Query: 1 EKLAIGLGLLNTPPGSSLRIIKNLRICGDCHVVIKFISNFEGREIFVRDTNRFHHFKDGV 180 EKLA+ LGLLNT PG L++IKNLRIC DCH VIKFIS+FE REIFVRDTNRFH FK GV Sbjct: 658 EKLAVVLGLLNTKPGFPLQVIKNLRICRDCHAVIKFISDFEKREIFVRDTNRFHQFKGGV 717 Query: 181 CSCGDYW 201 CSCGDYW Sbjct: 718 CSCGDYW 724 >ref|XP_006587447.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Glycine max] Length = 601 Score = 118 bits (295), Expect = 1e-24 Identities = 52/67 (77%), Positives = 57/67 (85%) Frame = +1 Query: 1 EKLAIGLGLLNTPPGSSLRIIKNLRICGDCHVVIKFISNFEGREIFVRDTNRFHHFKDGV 180 EKLA+ LGLLNT PG L++IKNLRIC DCH VIK IS EGREI+VRDTNR HHFKDGV Sbjct: 535 EKLAVVLGLLNTSPGQPLQVIKNLRICDDCHAVIKVISRLEGREIYVRDTNRLHHFKDGV 594 Query: 181 CSCGDYW 201 CSCGD+W Sbjct: 595 CSCGDFW 601