BLASTX nr result
ID: Akebia27_contig00045161
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00045161 (452 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005646117.1| hypothetical protein COCSUDRAFT_17393 [Cocco... 65 7e-09 >ref|XP_005646117.1| hypothetical protein COCSUDRAFT_17393 [Coccomyxa subellipsoidea C-169] gi|384248088|gb|EIE21573.1| hypothetical protein COCSUDRAFT_17393 [Coccomyxa subellipsoidea C-169] Length = 311 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = +1 Query: 1 VRIRVSDREDLVPGTQNRKVTISGPTECVQIAQVLINQKVN 123 V+IR+SDR+D VPGT+NRKVTISG + VQIAQVLI+QK+N Sbjct: 266 VKIRISDRDDFVPGTRNRKVTISGAADAVQIAQVLIHQKIN 306