BLASTX nr result
ID: Akebia27_contig00045151
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00045151 (394 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC94242.1| hypothetical protein BAUCODRAFT_36711 [Baudoinia ... 59 5e-07 >gb|EMC94242.1| hypothetical protein BAUCODRAFT_36711 [Baudoinia compniacensis UAMH 10762] Length = 204 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/56 (55%), Positives = 37/56 (66%) Frame = -1 Query: 172 KEPCDEDAPPCMTMDQATVVAQNFRQSIKNYSNESTIEHFTEDFTDYSASVNPLIN 5 K+ C++ CMT DQATVVA NF+ I YS+ IE T DFTDYS SV+ LIN Sbjct: 23 KKDCNDT---CMTYDQATVVANNFKSLIAAYSDADAIEFLTPDFTDYSDSVSTLIN 75