BLASTX nr result
ID: Akebia27_contig00044960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00044960 (336 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301147.1| hypothetical protein POPTR_0002s11900g [Popu... 55 8e-06 >ref|XP_002301147.1| hypothetical protein POPTR_0002s11900g [Populus trichocarpa] gi|222842873|gb|EEE80420.1| hypothetical protein POPTR_0002s11900g [Populus trichocarpa] Length = 269 Score = 55.5 bits (132), Expect = 8e-06 Identities = 40/112 (35%), Positives = 60/112 (53%), Gaps = 10/112 (8%) Frame = -1 Query: 336 VKYRDKKQDN---IKLNDNKEKAVAHNSEDLV---KSQTDLRSKEAEPTPRSRTDGRTRK 175 VK +D+KQD +++D K+K + HNS ++V +Q +K+AE PR TD +T K Sbjct: 108 VKAKDQKQDKPRASRVDDVKDKPINHNSTEVVYKLPTQAPAETKQAEQ-PRLETDKKTEK 166 Query: 174 K----NEYLIQRRRFNHDLPXXXXXXXXXXXIYGRSFAILCTSIWWYFVTTI 31 K + L + RR + +P +GRS AIL TS+ WY V T+ Sbjct: 167 KCFTWSIKLNRWRRPYYYMPVAIVLILLLLVFFGRSVAILWTSLGWYIVPTL 218