BLASTX nr result
ID: Akebia27_contig00044941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00044941 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006849462.1| hypothetical protein AMTR_s00024p00087360 [A... 63 8e-09 ref|XP_006849464.1| hypothetical protein AMTR_s00024p00088110 [A... 62 1e-08 >ref|XP_006849462.1| hypothetical protein AMTR_s00024p00087360 [Amborella trichopoda] gi|548853037|gb|ERN11043.1| hypothetical protein AMTR_s00024p00087360 [Amborella trichopoda] Length = 244 Score = 62.8 bits (151), Expect(2) = 8e-09 Identities = 27/52 (51%), Positives = 36/52 (69%) Frame = +3 Query: 81 SPLLPGIPNLSHVVIKLHRSNYILWKSQLLPILYGAEKLSMVDGTDSSGDDH 236 +P +P +PN SH IKL R++Y++WKSQLLPILY + L VDGT +H Sbjct: 15 APFVPRLPNFSHFTIKLDRNDYLIWKSQLLPILYSTDMLPFVDGTFVPPKEH 66 Score = 22.7 bits (47), Expect(2) = 8e-09 Identities = 9/25 (36%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = +1 Query: 220 HLEMITVDSESIP--NPAYLEWKKK 288 H+E + E + NP Y+ WKK+ Sbjct: 66 HIESVNESGEKMLALNPEYIAWKKE 90 >ref|XP_006849464.1| hypothetical protein AMTR_s00024p00088110 [Amborella trichopoda] gi|548853039|gb|ERN11045.1| hypothetical protein AMTR_s00024p00088110 [Amborella trichopoda] Length = 260 Score = 62.4 bits (150), Expect(2) = 1e-08 Identities = 27/52 (51%), Positives = 35/52 (67%) Frame = +3 Query: 81 SPLLPGIPNLSHVVIKLHRSNYILWKSQLLPILYGAEKLSMVDGTDSSGDDH 236 +P +P +PN SH IKL R+NY++WKSQ LPILY + L VDGT +H Sbjct: 15 APFVPRLPNFSHFTIKLDRNNYLIWKSQWLPILYSTDMLPFVDGTFVPPKEH 66 Score = 22.7 bits (47), Expect(2) = 1e-08 Identities = 9/25 (36%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = +1 Query: 220 HLEMITVDSESIP--NPAYLEWKKK 288 H+E + E + NP Y+ WKK+ Sbjct: 66 HIESVNESGEKMLALNPEYIAWKKE 90