BLASTX nr result
ID: Akebia27_contig00044901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00044901 (440 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002408819.1| cuticle protein, putative [Ixodes scapularis... 64 2e-08 ref|XP_002402093.1| conserved hypothetical protein [Ixodes scapu... 64 3e-08 ref|XP_002407797.1| conserved hypothetical protein [Ixodes scapu... 63 4e-08 ref|XP_002407786.1| conserved hypothetical protein [Ixodes scapu... 62 6e-08 ref|XP_002402092.1| cuticle protein, putative [Ixodes scapularis... 62 8e-08 ref|XP_002402097.1| cuticle protein, putative [Ixodes scapularis... 62 1e-07 ref|XP_002402098.1| cuticle protein, putative [Ixodes scapularis... 61 1e-07 ref|XP_003747727.1| PREDICTED: cuticle protein 14-like [Metaseiu... 61 2e-07 ref|XP_002406112.1| cuticular protein, putative [Ixodes scapular... 61 2e-07 ref|XP_002407795.1| cuticle protein, putative [Ixodes scapularis... 61 2e-07 ref|XP_002402096.1| cuticle protein, putative [Ixodes scapularis... 60 2e-07 ref|XP_002405919.1| cuticle protein, putative [Ixodes scapularis... 60 3e-07 ref|XP_003740367.1| PREDICTED: cuticle protein 16.8-like [Metase... 59 7e-07 ref|XP_002407790.1| conserved hypothetical protein [Ixodes scapu... 59 7e-07 ref|XP_003739045.1| PREDICTED: pupal cuticle protein Edg-84A-lik... 59 9e-07 ref|XP_002399778.1| cuticular protein, putative [Ixodes scapular... 59 9e-07 ref|XP_003738395.1| PREDICTED: uncharacterized protein LOC100903... 58 1e-06 ref|XP_002412191.1| hypothetical protein IscW_ISCW011576 [Ixodes... 58 1e-06 ref|XP_002409951.1| cuticle protein, putative [Ixodes scapularis... 58 2e-06 ref|XP_002407779.1| cuticle protein, putative [Ixodes scapularis... 58 2e-06 >ref|XP_002408819.1| cuticle protein, putative [Ixodes scapularis] gi|215494402|gb|EEC04043.1| cuticle protein, putative [Ixodes scapularis] Length = 159 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 1/56 (1%) Frame = +2 Query: 2 REESSDGR-TTRGSYSYIDADGVFRVVEYTADENGFNANIRTNEPGTSAAGPQQTD 166 R+ES DG T +GSY Y D +G++R V Y AD NGF A ++TNEPG A P + Sbjct: 85 RQESGDGSGTVKGSYGYTDTNGIYRQVSYVADANGFRATVKTNEPGVGPASPADAE 140 >ref|XP_002402093.1| conserved hypothetical protein [Ixodes scapularis] gi|215504656|gb|EEC14150.1| conserved hypothetical protein [Ixodes scapularis] Length = 346 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = +2 Query: 2 REESSDGRTTR-GSYSYIDADGVFRVVEYTADENGFNANIRTNEPGTSA 145 REE+SD + GSYSY DA GV R V+Y ADENGF A + TNEPGT + Sbjct: 128 REETSDANNAKVGSYSYTDASGVARTVKYVADENGFRATVETNEPGTKS 176 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/50 (52%), Positives = 33/50 (66%) Frame = +2 Query: 5 EESSDGRTTRGSYSYIDADGVFRVVEYTADENGFNANIRTNEPGTSAAGP 154 E + RGSYSY DA+G++RVV Y AD++GF I TNEPGT + P Sbjct: 49 ETGDEDNVKRGSYSYSDANGLYRVVNYIADKDGFRVTIDTNEPGTKTSAP 98 >ref|XP_002407797.1| conserved hypothetical protein [Ixodes scapularis] gi|215492288|gb|EEC01929.1| conserved hypothetical protein [Ixodes scapularis] Length = 402 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = +2 Query: 2 REESSDGRTTRGSYSYIDADGVFRVVEYTADENGFNANIRTNEPGTSAAGP 154 +EES +GSYSY DA+GV+RVV Y AD+ GF A IRTNEPGT+ P Sbjct: 72 KEESDVHNNRKGSYSYRDANGVYRVVNYVADKGGFRAWIRTNEPGTANQNP 122 >ref|XP_002407786.1| conserved hypothetical protein [Ixodes scapularis] gi|215492277|gb|EEC01918.1| conserved hypothetical protein [Ixodes scapularis] Length = 372 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Frame = +2 Query: 5 EESSDGRTTR-GSYSYIDADGVFRVVEYTADENGFNANIRTNEPGTSAAGPQQTDPAN 175 EES+D R GSY+Y DA G+ R V+YTAD +GF+A + TNEPGT ++ P A+ Sbjct: 75 EESADSNNARVGSYTYSDASGIARTVKYTADASGFHATVETNEPGTKSSAPADVQYAS 132 >ref|XP_002402092.1| cuticle protein, putative [Ixodes scapularis] gi|215504655|gb|EEC14149.1| cuticle protein, putative [Ixodes scapularis] Length = 374 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/52 (51%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = +2 Query: 2 REESSDGRTTR-GSYSYIDADGVFRVVEYTADENGFNANIRTNEPGTSAAGP 154 R E+SD + GSY Y D +G++R V+Y AD NGF A +RTNEPGT+ + P Sbjct: 159 RHETSDANNAKKGSYGYTDTNGIYRQVDYIADANGFRATVRTNEPGTAPSAP 210 >ref|XP_002402097.1| cuticle protein, putative [Ixodes scapularis] gi|215504660|gb|EEC14154.1| cuticle protein, putative [Ixodes scapularis] Length = 207 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/52 (53%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = +2 Query: 2 REESSDGRTTR-GSYSYIDADGVFRVVEYTADENGFNANIRTNEPGTSAAGP 154 REE+ D + GSYSY DA GVFR V+Y A+ +GF+A + TNEPGT ++ P Sbjct: 28 REETGDANNNKVGSYSYTDAAGVFRTVKYVANADGFHATVETNEPGTKSSNP 79 >ref|XP_002402098.1| cuticle protein, putative [Ixodes scapularis] gi|215504661|gb|EEC14155.1| cuticle protein, putative [Ixodes scapularis] Length = 185 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/52 (57%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = +2 Query: 2 REESSDGRTTR-GSYSYIDADGVFRVVEYTADENGFNANIRTNEPGTSAAGP 154 +EES D + GSYSY DA GVFR V+Y AD GF A I TNEPGT ++ P Sbjct: 23 QEESGDVNNNKVGSYSYTDAAGVFRTVKYVADGEGFRATIETNEPGTKSSNP 74 >ref|XP_003747727.1| PREDICTED: cuticle protein 14-like [Metaseiulus occidentalis] Length = 166 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +2 Query: 2 REESSDGR-TTRGSYSYIDADGVFRVVEYTADENGFNANIRTNEPGTSAAGPQQT 163 REE +DG GSY + DA+G++R V Y AD+ GF A ++TNEPGT+++ P T Sbjct: 85 REEQADGHGNVVGSYGFTDANGIYRQVNYVADKFGFRAQVKTNEPGTASSNPADT 139 >ref|XP_002406112.1| cuticular protein, putative [Ixodes scapularis] gi|215496854|gb|EEC06494.1| cuticular protein, putative [Ixodes scapularis] Length = 88 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/52 (57%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = +2 Query: 2 REESSDG-RTTRGSYSYIDADGVFRVVEYTADENGFNANIRTNEPGTSAAGP 154 REE SDG RGSY Y DA G +R VEY AD+ GF A + TNEPGT++ P Sbjct: 24 REEKSDGVGNVRGSYGYTDAYGHYRQVEYVADQYGFRAKVLTNEPGTASKNP 75 >ref|XP_002407795.1| cuticle protein, putative [Ixodes scapularis] gi|215492286|gb|EEC01927.1| cuticle protein, putative [Ixodes scapularis] Length = 170 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/52 (57%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = +2 Query: 2 REESSD-GRTTRGSYSYIDADGVFRVVEYTADENGFNANIRTNEPGTSAAGP 154 R+ES D G +GSYSY D +G+FR V Y AD +GF A+I+TNEPGT +GP Sbjct: 81 RQESGDSGNVKKGSYSYTDPNGIFRQVNYIADADGFRASIQTNEPGTQ-SGP 131 >ref|XP_002402096.1| cuticle protein, putative [Ixodes scapularis] gi|215504659|gb|EEC14153.1| cuticle protein, putative [Ixodes scapularis] Length = 186 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 1/56 (1%) Frame = +2 Query: 2 REESSDGRTTR-GSYSYIDADGVFRVVEYTADENGFNANIRTNEPGTSAAGPQQTD 166 R+E+ D T+ GSYSY DA G+ R V+Y AD +GF A + TNEPGT + P T+ Sbjct: 43 RQETGDKDNTKIGSYSYTDAYGITRTVKYVADADGFRAKVETNEPGTKTSSPADTE 98 >ref|XP_002405919.1| cuticle protein, putative [Ixodes scapularis] gi|215502586|gb|EEC12080.1| cuticle protein, putative [Ixodes scapularis] Length = 140 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/48 (58%), Positives = 33/48 (68%), Gaps = 1/48 (2%) Frame = +2 Query: 5 EESSDGRTTR-GSYSYIDADGVFRVVEYTADENGFNANIRTNEPGTSA 145 +E SD R GSY Y+DA+G++R V Y AD NGF A I TNEPGT A Sbjct: 20 QEQSDANNARTGSYGYMDANGIYRRVNYVADANGFRATIETNEPGTQA 67 >ref|XP_003740367.1| PREDICTED: cuticle protein 16.8-like [Metaseiulus occidentalis] Length = 124 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/53 (50%), Positives = 35/53 (66%) Frame = +2 Query: 5 EESSDGRTTRGSYSYIDADGVFRVVEYTADENGFNANIRTNEPGTSAAGPQQT 163 EES +GSYS+ DA G+ R V+Y ADE+GF A + TNEPGT+ + P T Sbjct: 27 EESDAQNRKKGSYSFTDAYGITRRVDYVADEHGFRATVNTNEPGTAPSQPAST 79 >ref|XP_002407790.1| conserved hypothetical protein [Ixodes scapularis] gi|215492281|gb|EEC01922.1| conserved hypothetical protein [Ixodes scapularis] Length = 370 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/48 (52%), Positives = 37/48 (77%) Frame = +2 Query: 5 EESSDGRTTRGSYSYIDADGVFRVVEYTADENGFNANIRTNEPGTSAA 148 EES +GSY + DA+G++R V+Y ADE+GF A+I+TNEPGT+++ Sbjct: 120 EESDANNIKKGSYGFHDANGIYRHVKYVADEHGFRASIQTNEPGTASS 167 >ref|XP_003739045.1| PREDICTED: pupal cuticle protein Edg-84A-like [Metaseiulus occidentalis] Length = 195 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = +2 Query: 11 SSDGRTTRGSYSYIDADGVFRVVEYTADENGFNANIRTNEPGTSAAGP 154 SSDG+T G YS + ADG R V+YTADENG+ A I TNE GT + P Sbjct: 62 SSDGKTVTGQYSIMLADGRMRTVKYTADENGYRAEIITNELGTESKNP 109 >ref|XP_002399778.1| cuticular protein, putative [Ixodes scapularis] gi|215497581|gb|EEC07075.1| cuticular protein, putative [Ixodes scapularis] Length = 196 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/47 (59%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = +2 Query: 5 EESSDGRTTR-GSYSYIDADGVFRVVEYTADENGFNANIRTNEPGTS 142 + SSD R GSY Y + DG+FR+VEY ADENG+ A I+TNEPGT+ Sbjct: 133 QSSSDASGKRTGSYGYTNKDGLFRLVEYEADENGYRAVIKTNEPGTA 179 >ref|XP_003738395.1| PREDICTED: uncharacterized protein LOC100903298 [Metaseiulus occidentalis] Length = 305 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = +2 Query: 5 EESSDGRTTRGSYSYIDADGVFRVVEYTADENGFNANIRTNEPGTSAAGP 154 E S + +GSYS+ DA G+ R VEY AD +GF A I+TNEPGT+++ P Sbjct: 182 EVSDEHNNKKGSYSFTDARGISRHVEYVADGHGFRAQIKTNEPGTASSAP 231 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/50 (50%), Positives = 35/50 (70%) Frame = +2 Query: 5 EESSDGRTTRGSYSYIDADGVFRVVEYTADENGFNANIRTNEPGTSAAGP 154 E S + +GSYS+ DA G+ R V+Y AD +GF A+I+TNEPGT+ + P Sbjct: 98 EVSDEYNNKKGSYSFSDAHGIARQVDYVADGHGFRASIKTNEPGTAPSAP 147 >ref|XP_002412191.1| hypothetical protein IscW_ISCW011576 [Ixodes scapularis] gi|215505364|gb|EEC14858.1| hypothetical protein IscW_ISCW011576 [Ixodes scapularis] Length = 242 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/52 (57%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = +2 Query: 2 REESSDGR-TTRGSYSYIDADGVFRVVEYTADENGFNANIRTNEPGTSAAGP 154 REES+DG GSY+ ADG+ R V Y ADENGF A+I TNEPGT + P Sbjct: 19 REESADGSGRVVGSYTIFTADGLERRVYYEADENGFRAHIETNEPGTKTSNP 70 >ref|XP_002409951.1| cuticle protein, putative [Ixodes scapularis] gi|215503266|gb|EEC12760.1| cuticle protein, putative [Ixodes scapularis] Length = 189 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/48 (52%), Positives = 31/48 (64%) Frame = +2 Query: 2 REESSDGRTTRGSYSYIDADGVFRVVEYTADENGFNANIRTNEPGTSA 145 +EE+ GSY Y DA+G++R V Y AD NGF A I TNEPGT + Sbjct: 68 KEEADANNARTGSYGYTDANGIYRRVNYVADANGFRATIETNEPGTQS 115 >ref|XP_002407779.1| cuticle protein, putative [Ixodes scapularis] gi|215492270|gb|EEC01911.1| cuticle protein, putative [Ixodes scapularis] Length = 158 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/52 (51%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +2 Query: 2 REESSDGRTTR-GSYSYIDADGVFRVVEYTADENGFNANIRTNEPGTSAAGP 154 R+E+ D + GSYSY+DA GV R V Y AD GF A + TNEPGT + P Sbjct: 45 RQETGDALNNKVGSYSYVDAHGVARTVNYVADALGFRATVETNEPGTKTSAP 96