BLASTX nr result
ID: Akebia27_contig00044716
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00044716 (388 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005650981.1| chlorophyll a/b-binding protein [Coccomyxa s... 86 4e-15 ref|XP_001779229.1| predicted protein [Physcomitrella patens] gi... 86 5e-15 gb|AEW70716.1| light harvesting chlorophyll a-b binding protein ... 84 2e-14 gb|ACE88963.1| chloroplast chlorophyll a/b binding protein [Phyl... 84 2e-14 gb|ABQ02463.1| chloroplast chlorophyll a/b binding protein [Phyl... 84 2e-14 gb|AHM26643.1| a-b binding protein [Pyrus x bretschneideri] 84 3e-14 gb|EXB69297.1| Chlorophyll a-b binding protein 40 [Morus notabilis] 84 3e-14 ref|XP_004293580.1| PREDICTED: chlorophyll a-b binding protein 4... 84 3e-14 ref|XP_004148579.1| PREDICTED: chlorophyll a-b binding protein 3... 84 3e-14 gb|AAD27879.2|AF139467_1 LHCII type I chlorophyll a/b binding pr... 84 3e-14 ref|NP_001235283.1| chlorophyll a/b-binding protein [Glycine max... 84 3e-14 ref|XP_005651359.1| major light-harvesting complex II protein m1... 84 3e-14 gb|AEY85026.1| light-harvesting complex II protein [Cajanus cajan] 84 3e-14 ref|XP_005846357.1| hypothetical protein CHLNCDRAFT_56227 [Chlor... 84 3e-14 gb|ACU23816.1| unknown [Glycine max] 84 3e-14 ref|XP_005651417.1| chlorophyll a/b-binding protein [Coccomyxa s... 83 5e-14 ref|NP_001266111.1| chlorophyll a-b binding protein AB80, chloro... 82 6e-14 dbj|BAA24493.1| chlorophyll a/b-binding protein [Fagus crenata] 82 6e-14 ref|XP_006467511.1| PREDICTED: chlorophyll a-b binding protein 3... 82 6e-14 ref|XP_006467509.1| PREDICTED: chlorophyll a-b binding protein 3... 82 6e-14 >ref|XP_005650981.1| chlorophyll a/b-binding protein [Coccomyxa subellipsoidea C-169] gi|384252962|gb|EIE26437.1| chlorophyll a/b-binding protein [Coccomyxa subellipsoidea C-169] Length = 245 Score = 86.3 bits (212), Expect = 4e-15 Identities = 37/45 (82%), Positives = 39/45 (86%) Frame = +1 Query: 250 EWYGPSRPGFLGPFTNPPDYLRGEFAGDYGWDTAGLSADPETFAR 384 E+YGP R GFLGPFT P YL+GEF GDYGWDTAGLSADPETFAR Sbjct: 30 EFYGPDRAGFLGPFTESPSYLKGEFPGDYGWDTAGLSADPETFAR 74 >ref|XP_001779229.1| predicted protein [Physcomitrella patens] gi|162669328|gb|EDQ55917.1| predicted protein [Physcomitrella patens] Length = 266 Score = 85.9 bits (211), Expect = 5e-15 Identities = 38/49 (77%), Positives = 41/49 (83%), Gaps = 1/49 (2%) Frame = +1 Query: 244 GGEWYGPSRPGFLGPFT-NPPDYLRGEFAGDYGWDTAGLSADPETFARN 387 G WYGP RP FLGPF+ N P YL+GEF GDYGWDTAGLSADPE+FARN Sbjct: 45 GSMWYGPDRPLFLGPFSGNTPSYLKGEFPGDYGWDTAGLSADPESFARN 93 >gb|AEW70716.1| light harvesting chlorophyll a-b binding protein 2-1 [Phyllostachys edulis] Length = 263 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/46 (80%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = +1 Query: 253 WYGPSRPGFLGPFTNP-PDYLRGEFAGDYGWDTAGLSADPETFARN 387 WYGP RP +LGPF+ P YL GEFAGDYGWDTAGLSADPETFARN Sbjct: 47 WYGPDRPKYLGPFSEQTPSYLTGEFAGDYGWDTAGLSADPETFARN 92 >gb|ACE88963.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis] Length = 181 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/46 (80%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = +1 Query: 253 WYGPSRPGFLGPFTNP-PDYLRGEFAGDYGWDTAGLSADPETFARN 387 WYGP RP +LGPF+ P YL GEFAGDYGWDTAGLSADPETFARN Sbjct: 40 WYGPDRPKYLGPFSEQTPSYLTGEFAGDYGWDTAGLSADPETFARN 85 >gb|ABQ02463.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis] Length = 263 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/46 (80%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = +1 Query: 253 WYGPSRPGFLGPFTNP-PDYLRGEFAGDYGWDTAGLSADPETFARN 387 WYGP RP +LGPF+ P YL GEFAGDYGWDTAGLSADPETFARN Sbjct: 47 WYGPDRPKYLGPFSEQTPSYLTGEFAGDYGWDTAGLSADPETFARN 92 >gb|AHM26643.1| a-b binding protein [Pyrus x bretschneideri] Length = 264 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/49 (73%), Positives = 40/49 (81%), Gaps = 1/49 (2%) Frame = +1 Query: 244 GGEWYGPSRPGFLGPFTN-PPDYLRGEFAGDYGWDTAGLSADPETFARN 387 G WYGP R +LGPF+ PP YL+GEF GDYGWDTAGLSADPETFA+N Sbjct: 45 GSPWYGPDRVKYLGPFSGEPPSYLKGEFPGDYGWDTAGLSADPETFAKN 93 >gb|EXB69297.1| Chlorophyll a-b binding protein 40 [Morus notabilis] Length = 265 Score = 83.6 bits (205), Expect = 3e-14 Identities = 37/49 (75%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = +1 Query: 244 GGEWYGPSRPGFLGPFTN-PPDYLRGEFAGDYGWDTAGLSADPETFARN 387 G WYGP R +LGPF+ PP YL GEF GDYGWDTAGLSADPETFARN Sbjct: 46 GSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARN 94 >ref|XP_004293580.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 263 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/49 (73%), Positives = 40/49 (81%), Gaps = 1/49 (2%) Frame = +1 Query: 244 GGEWYGPSRPGFLGPFTN-PPDYLRGEFAGDYGWDTAGLSADPETFARN 387 G WYGP R +LGPF+ PP YL+GEF GDYGWDTAGLSADPETFA+N Sbjct: 44 GSPWYGPDRVKYLGPFSGEPPSYLKGEFPGDYGWDTAGLSADPETFAKN 92 >ref|XP_004148579.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like [Cucumis sativus] gi|449518125|ref|XP_004166094.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like [Cucumis sativus] Length = 265 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/49 (73%), Positives = 40/49 (81%), Gaps = 1/49 (2%) Frame = +1 Query: 244 GGEWYGPSRPGFLGPFTN-PPDYLRGEFAGDYGWDTAGLSADPETFARN 387 G WYGP R +LGPF+ PP YL+GEF GDYGWDTAGLSADPETFA+N Sbjct: 46 GSPWYGPDRVKYLGPFSGEPPSYLKGEFPGDYGWDTAGLSADPETFAKN 94 >gb|AAD27879.2|AF139467_1 LHCII type I chlorophyll a/b binding protein [Vigna radiata] Length = 263 Score = 83.6 bits (205), Expect = 3e-14 Identities = 37/49 (75%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = +1 Query: 244 GGEWYGPSRPGFLGPFTN-PPDYLRGEFAGDYGWDTAGLSADPETFARN 387 G WYGP R +LGPF+ PP YL GEF GDYGWDTAGLSADPETFARN Sbjct: 44 GSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARN 92 >ref|NP_001235283.1| chlorophyll a/b-binding protein [Glycine max] gi|1053216|gb|AAA80688.1| chlorophyll a/b-binding protein [Glycine max] Length = 263 Score = 83.6 bits (205), Expect = 3e-14 Identities = 37/49 (75%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = +1 Query: 244 GGEWYGPSRPGFLGPFTN-PPDYLRGEFAGDYGWDTAGLSADPETFARN 387 G WYGP R +LGPF+ PP YL GEF GDYGWDTAGLSADPETFARN Sbjct: 44 GSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARN 92 >ref|XP_005651359.1| major light-harvesting complex II protein m10 [Coccomyxa subellipsoidea C-169] gi|384253340|gb|EIE26815.1| major light-harvesting complex II protein m10 [Coccomyxa subellipsoidea C-169] Length = 250 Score = 83.6 bits (205), Expect = 3e-14 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +1 Query: 250 EWYGPSRPGFLGPFTNPPDYLRGEFAGDYGWDTAGLSADPETFAR 384 E+YGP+R G+LGPFT P YL GE+ GDYGWDTAGLSADPETFAR Sbjct: 35 EFYGPNRAGYLGPFTKSPSYLNGEYPGDYGWDTAGLSADPETFAR 79 >gb|AEY85026.1| light-harvesting complex II protein [Cajanus cajan] Length = 262 Score = 83.6 bits (205), Expect = 3e-14 Identities = 37/49 (75%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = +1 Query: 244 GGEWYGPSRPGFLGPFTN-PPDYLRGEFAGDYGWDTAGLSADPETFARN 387 G WYGP R +LGPF+ PP YL GEF GDYGWDTAGLSADPETFARN Sbjct: 43 GSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARN 91 >ref|XP_005846357.1| hypothetical protein CHLNCDRAFT_56227 [Chlorella variabilis] gi|307106008|gb|EFN54255.1| hypothetical protein CHLNCDRAFT_56227 [Chlorella variabilis] Length = 248 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 1/46 (2%) Frame = +1 Query: 250 EWYGPSRPGFLGPFT-NPPDYLRGEFAGDYGWDTAGLSADPETFAR 384 EWYGP+RP FLGPF+ + P YL+GE+ GDYGWDTAGLSADPETFAR Sbjct: 28 EWYGPNRPQFLGPFSGSTPSYLKGEYPGDYGWDTAGLSADPETFAR 73 >gb|ACU23816.1| unknown [Glycine max] Length = 263 Score = 83.6 bits (205), Expect = 3e-14 Identities = 37/49 (75%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = +1 Query: 244 GGEWYGPSRPGFLGPFTN-PPDYLRGEFAGDYGWDTAGLSADPETFARN 387 G WYGP R +LGPF+ PP YL GEF GDYGWDTAGLSADPETFARN Sbjct: 44 GSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARN 92 >ref|XP_005651417.1| chlorophyll a/b-binding protein [Coccomyxa subellipsoidea C-169] gi|384253398|gb|EIE26873.1| chlorophyll a/b-binding protein [Coccomyxa subellipsoidea C-169] Length = 250 Score = 82.8 bits (203), Expect = 5e-14 Identities = 36/45 (80%), Positives = 38/45 (84%) Frame = +1 Query: 250 EWYGPSRPGFLGPFTNPPDYLRGEFAGDYGWDTAGLSADPETFAR 384 E+YGP R FLGPFT+ P YL GEF GDYGWDTAGLSADPETFAR Sbjct: 35 EFYGPDRATFLGPFTDTPSYLNGEFPGDYGWDTAGLSADPETFAR 79 >ref|NP_001266111.1| chlorophyll a-b binding protein AB80, chloroplastic-like [Cicer arietinum] gi|3928140|emb|CAA10284.1| chlorophyll a/b binding protein [Cicer arietinum] Length = 266 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/49 (73%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = +1 Query: 244 GGEWYGPSRPGFLGPFTN-PPDYLRGEFAGDYGWDTAGLSADPETFARN 387 G WYGP R +LGPF+ PP YL GEF GDYGWDTAGLSADPETFA+N Sbjct: 47 GSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKN 95 >dbj|BAA24493.1| chlorophyll a/b-binding protein [Fagus crenata] Length = 264 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/49 (73%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = +1 Query: 244 GGEWYGPSRPGFLGPFTN-PPDYLRGEFAGDYGWDTAGLSADPETFARN 387 G WYGP R +LGPF+ PP YL GEF GDYGWDTAGLSADPETFA+N Sbjct: 45 GSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKN 93 >ref|XP_006467511.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like [Citrus sinensis] Length = 399 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/49 (73%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = +1 Query: 244 GGEWYGPSRPGFLGPFTN-PPDYLRGEFAGDYGWDTAGLSADPETFARN 387 G WYGP R +LGPF+ PP YL GEF GDYGWDTAGLSADPETFA+N Sbjct: 45 GSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKN 93 >ref|XP_006467509.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like [Citrus sinensis] Length = 264 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/49 (73%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = +1 Query: 244 GGEWYGPSRPGFLGPFTN-PPDYLRGEFAGDYGWDTAGLSADPETFARN 387 G WYGP R +LGPF+ PP YL GEF GDYGWDTAGLSADPETFA+N Sbjct: 45 GSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKN 93