BLASTX nr result
ID: Akebia27_contig00044604
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00044604 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC28019.1| Cell division protein FtsY-like protein [Morus no... 60 2e-07 ref|XP_002511808.1| cell division protein ftsy, putative [Ricinu... 58 1e-06 ref|XP_007051904.1| Signal recognition particle receptor protein... 57 3e-06 ref|XP_007051903.1| Signal recognition particle receptor protein... 57 3e-06 ref|XP_004306830.1| PREDICTED: cell division protein FtsY homolo... 56 4e-06 ref|XP_003521235.1| PREDICTED: cell division protein FtsY homolo... 56 4e-06 ref|XP_007135001.1| hypothetical protein PHAVU_010G093600g [Phas... 56 6e-06 ref|XP_007220367.1| hypothetical protein PRUPE_ppa016987mg [Prun... 56 6e-06 ref|XP_007218168.1| hypothetical protein PRUPE_ppa007514mg [Prun... 56 6e-06 ref|XP_004133877.1| PREDICTED: cell division protein FtsY homolo... 56 6e-06 ref|XP_006583338.1| PREDICTED: cell division protein FtsY homolo... 56 6e-06 ref|XP_006397776.1| hypothetical protein EUTSA_v10001508mg [Eutr... 55 8e-06 ref|XP_006294469.1| hypothetical protein CARUB_v10023482mg [Caps... 55 8e-06 ref|XP_002269433.1| PREDICTED: cell division protein FtsY homolo... 55 8e-06 >gb|EXC28019.1| Cell division protein FtsY-like protein [Morus notabilis] Length = 371 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 316 LHTNYSLMEELIACKKSVGKVVPGAPNVSLTI 221 LHTNYSLMEELIACKK+VGKVV GAPN SLT+ Sbjct: 257 LHTNYSLMEELIACKKAVGKVVSGAPNASLTL 288 >ref|XP_002511808.1| cell division protein ftsy, putative [Ricinus communis] gi|223548988|gb|EEF50477.1| cell division protein ftsy, putative [Ricinus communis] Length = 362 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 316 LHTNYSLMEELIACKKSVGKVVPGAPNVSLTI 221 LHTNYSLMEELIACKK++GKVVPGAPN L + Sbjct: 255 LHTNYSLMEELIACKKAIGKVVPGAPNEILLV 286 >ref|XP_007051904.1| Signal recognition particle receptor protein, chloroplast (FTSY) isoform 2 [Theobroma cacao] gi|508704165|gb|EOX96061.1| Signal recognition particle receptor protein, chloroplast (FTSY) isoform 2 [Theobroma cacao] Length = 365 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 316 LHTNYSLMEELIACKKSVGKVVPGAPNVSLTI 221 LHTN+SLMEELIACKK+VGKV+PGAPN L + Sbjct: 258 LHTNFSLMEELIACKKAVGKVIPGAPNEILLV 289 >ref|XP_007051903.1| Signal recognition particle receptor protein isoform 1 [Theobroma cacao] gi|508704164|gb|EOX96060.1| Signal recognition particle receptor protein isoform 1 [Theobroma cacao] Length = 445 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 316 LHTNYSLMEELIACKKSVGKVVPGAPNVSLTI 221 LHTN+SLMEELIACKK+VGKV+PGAPN L + Sbjct: 338 LHTNFSLMEELIACKKAVGKVIPGAPNEILLV 369 >ref|XP_004306830.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 365 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 316 LHTNYSLMEELIACKKSVGKVVPGAPNVSLTI 221 LHTNYSLMEELIACKK+VGKV+PG+PN L + Sbjct: 258 LHTNYSLMEELIACKKAVGKVMPGSPNEILQV 289 >ref|XP_003521235.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like isoform X1 [Glycine max] gi|571443916|ref|XP_006576355.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like isoform X2 [Glycine max] Length = 372 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 316 LHTNYSLMEELIACKKSVGKVVPGAPNVSLTI 221 LHTNYSLMEELI+CKKSV KVVPGAPN L + Sbjct: 265 LHTNYSLMEELISCKKSVAKVVPGAPNEILLV 296 >ref|XP_007135001.1| hypothetical protein PHAVU_010G093600g [Phaseolus vulgaris] gi|561008046|gb|ESW06995.1| hypothetical protein PHAVU_010G093600g [Phaseolus vulgaris] Length = 371 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -3 Query: 316 LHTNYSLMEELIACKKSVGKVVPGAPNVSLTI 221 LHTNYSLMEELI+CKKSV KV+PGAPN L + Sbjct: 264 LHTNYSLMEELISCKKSVAKVIPGAPNEILLV 295 >ref|XP_007220367.1| hypothetical protein PRUPE_ppa016987mg [Prunus persica] gi|462416829|gb|EMJ21566.1| hypothetical protein PRUPE_ppa016987mg [Prunus persica] Length = 333 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -3 Query: 316 LHTNYSLMEELIACKKSVGKVVPGAPNVSLTI 221 LHTNYSLMEELIACKK+V KV+PGAPN L + Sbjct: 226 LHTNYSLMEELIACKKAVSKVIPGAPNEILQV 257 >ref|XP_007218168.1| hypothetical protein PRUPE_ppa007514mg [Prunus persica] gi|462414630|gb|EMJ19367.1| hypothetical protein PRUPE_ppa007514mg [Prunus persica] Length = 365 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -3 Query: 316 LHTNYSLMEELIACKKSVGKVVPGAPNVSLTI 221 LHTNYSLMEELIACKK+V KV+PGAPN L + Sbjct: 258 LHTNYSLMEELIACKKAVSKVIPGAPNEILQV 289 >ref|XP_004133877.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Cucumis sativus] gi|449480150|ref|XP_004155813.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Cucumis sativus] Length = 368 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -3 Query: 316 LHTNYSLMEELIACKKSVGKVVPGAPNVSLTI 221 LHTNYSLMEELIACKK+V KV+PGAPN L + Sbjct: 261 LHTNYSLMEELIACKKAVAKVIPGAPNEILQV 292 >ref|XP_006583338.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Glycine max] Length = 372 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -3 Query: 316 LHTNYSLMEELIACKKSVGKVVPGAPNVSLTI 221 LHTNYSLMEELI+CKKSV KV+PGAPN L + Sbjct: 265 LHTNYSLMEELISCKKSVAKVIPGAPNEILLV 296 >ref|XP_006397776.1| hypothetical protein EUTSA_v10001508mg [Eutrema salsugineum] gi|557098849|gb|ESQ39229.1| hypothetical protein EUTSA_v10001508mg [Eutrema salsugineum] Length = 366 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 316 LHTNYSLMEELIACKKSVGKVVPGAPNVSLTI 221 LHTNYSLMEELIACKK+VGKVV GAPN L + Sbjct: 259 LHTNYSLMEELIACKKAVGKVVSGAPNEILLV 290 >ref|XP_006294469.1| hypothetical protein CARUB_v10023482mg [Capsella rubella] gi|565473494|ref|XP_006294470.1| hypothetical protein CARUB_v10023482mg [Capsella rubella] gi|482563177|gb|EOA27367.1| hypothetical protein CARUB_v10023482mg [Capsella rubella] gi|482563178|gb|EOA27368.1| hypothetical protein CARUB_v10023482mg [Capsella rubella] Length = 366 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 316 LHTNYSLMEELIACKKSVGKVVPGAPNVSLTI 221 LHTNYSLMEELIACKK+VGKVV GAPN L + Sbjct: 259 LHTNYSLMEELIACKKAVGKVVSGAPNEILLV 290 >ref|XP_002269433.1| PREDICTED: cell division protein FtsY homolog, chloroplastic [Vitis vinifera] gi|296089055|emb|CBI38758.3| unnamed protein product [Vitis vinifera] Length = 367 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 316 LHTNYSLMEELIACKKSVGKVVPGAPNVSLTI 221 LHTNYSLMEELIACKK+VGKVV GAPN L + Sbjct: 260 LHTNYSLMEELIACKKAVGKVVSGAPNEILLV 291