BLASTX nr result
ID: Akebia27_contig00044492
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00044492 (409 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS83805.1| hypothetical protein PFICI_05681 [Pestalotiopsis ... 75 1e-11 gb|EMR62186.1| hypothetical protein UCREL1_10878 [Eutypa lata UC... 60 3e-07 >gb|ETS83805.1| hypothetical protein PFICI_05681 [Pestalotiopsis fici W106-1] Length = 207 Score = 75.1 bits (183), Expect = 1e-11 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = +2 Query: 257 MATFEVTRDMRGAAQDPKREKEQYAKWSRGTRPSAGCQINFWDPDTPLTGS 409 MA+FEVTRD+RGAAQDPKR KE+YAKW+ GTRPS+GC+ + D +T + GS Sbjct: 1 MASFEVTRDIRGAAQDPKRAKEKYAKWANGTRPSSGCKYSTMDFETIVGGS 51 >gb|EMR62186.1| hypothetical protein UCREL1_10878 [Eutypa lata UCREL1] Length = 205 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/48 (58%), Positives = 32/48 (66%) Frame = +2 Query: 266 FEVTRDMRGAAQDPKREKEQYAKWSRGTRPSAGCQINFWDPDTPLTGS 409 FE T+D R A Q KR KE AKWS G+RPS G Q + W+PD LTGS Sbjct: 3 FEQTKDFRSATQSSKRFKEHKAKWSLGSRPSPGVQYSIWNPDVFLTGS 50