BLASTX nr result
ID: Akebia27_contig00044036
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00044036 (411 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005652098.1| hypothetical protein COCSUDRAFT_45911 [Cocco... 67 2e-09 >ref|XP_005652098.1| hypothetical protein COCSUDRAFT_45911 [Coccomyxa subellipsoidea C-169] gi|384254080|gb|EIE27554.1| hypothetical protein COCSUDRAFT_45911 [Coccomyxa subellipsoidea C-169] Length = 506 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/51 (54%), Positives = 40/51 (78%) Frame = +2 Query: 2 IAQVAFKKYVIDRILEDDGVTGDQYGPYDADTIKEERHRLKSQKANAKARR 154 +AQ+AFK V+DR+LE+DGVTGD YGPYD + ++EER R+ +K +AR+ Sbjct: 413 LAQIAFKVLVLDRVLEEDGVTGDAYGPYDPEFVQEERERIAREKERERARK 463