BLASTX nr result
ID: Akebia27_contig00043960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00043960 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006362709.1| PREDICTED: putative ribonuclease H protein A... 59 9e-07 >ref|XP_006362709.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Solanum tuberosum] Length = 217 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/67 (34%), Positives = 35/67 (52%) Frame = -2 Query: 265 PNSVLSLFQIWNQNPFVGKKRYLWSITPFAVCWVVWQERNRRVFKGKVTGFKILSGRCLA 86 P S++ + Q WN++ GK W I P + W +W+ERN+R F+GK + + CL Sbjct: 134 PGSIIEVLQCWNRDGNAGKNEKRWRIVPACIWWTIWKERNQRCFEGKQNNIQKIKTNCLG 193 Query: 85 SCLFGAK 65 F K Sbjct: 194 LYYFWCK 200