BLASTX nr result
ID: Akebia27_contig00043940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00043940 (467 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC94073.1| hypothetical protein BAUCODRAFT_36548 [Baudoinia ... 74 2e-11 gb|EMF13133.1| Annexin [Sphaerulina musiva SO2202] 65 1e-08 ref|XP_001208744.1| conserved hypothetical protein [Aspergillus ... 64 2e-08 ref|XP_001275766.1| annexin ANXC3.2 [Aspergillus clavatus NRRL 1... 64 3e-08 tpe|CBF86831.1| TPA: annexin, putative (Eurofung) [Aspergillus n... 63 5e-08 ref|XP_660031.1| hypothetical protein AN2427.2 [Aspergillus nidu... 63 5e-08 gb|EPS33423.1| hypothetical protein PDE_08385 [Penicillium oxali... 62 8e-08 gb|EZF34726.1| hypothetical protein H101_01734 [Trichophyton int... 62 1e-07 dbj|GAD96167.1| annexin ANXC3.2 [Byssochlamys spectabilis No. 5] 62 1e-07 gb|EGE08744.1| annexin A7 [Trichophyton equinum CBS 127.97] 62 1e-07 gb|EGE00386.1| annexin [Trichophyton tonsurans CBS 112818] 62 1e-07 ref|XP_003236627.1| annexin [Trichophyton rubrum CBS 118892] gi|... 61 2e-07 ref|XP_003022577.1| annexin ANXC3.1 [Trichophyton verrucosum HKI... 61 2e-07 ref|XP_003013023.1| annexin ANXC3.1 [Arthroderma benhamiae CBS 1... 61 2e-07 ref|XP_001260847.1| annexin ANXC3.2 [Neosartorya fischeri NRRL 1... 60 2e-07 gb|EXJ64197.1| hypothetical protein A1O7_00533 [Cladophialophora... 60 3e-07 ref|XP_755722.1| annexin ANXC3.2 [Aspergillus fumigatus Af293] g... 60 3e-07 gb|ETI28130.1| hypothetical protein G647_00579 [Cladophialophora... 60 3e-07 ref|XP_003174898.1| annexin A7 [Arthroderma gypseum CBS 118893] ... 60 3e-07 gb|ETN39785.1| hypothetical protein HMPREF1541_06011 [Cyphelloph... 60 4e-07 >gb|EMC94073.1| hypothetical protein BAUCODRAFT_36548 [Baudoinia compniacensis UAMH 10762] Length = 450 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/52 (67%), Positives = 44/52 (84%) Frame = -1 Query: 158 SEGYVPGQQAQQDMSRAADDLRSAMKGFGTNEGALIKVLAGLSPLQVNSVKA 3 S GYVPGQQ+Q DMS+AA LR+AMKGFGT+E ALI++L L PL++NSVK+ Sbjct: 126 SPGYVPGQQSQMDMSQAAHGLRAAMKGFGTDEKALIRILGQLGPLEINSVKS 177 >gb|EMF13133.1| Annexin [Sphaerulina musiva SO2202] Length = 449 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/51 (60%), Positives = 41/51 (80%) Frame = -1 Query: 158 SEGYVPGQQAQQDMSRAADDLRSAMKGFGTNEGALIKVLAGLSPLQVNSVK 6 S GY Q++ QD++RAADDLR++MKGFGTNE LIKV+A L PL++ +VK Sbjct: 133 SPGYDLRQRSHQDVTRAADDLRASMKGFGTNETLLIKVMASLGPLEIAAVK 183 >ref|XP_001208744.1| conserved hypothetical protein [Aspergillus terreus NIH2624] gi|114196436|gb|EAU38136.1| conserved hypothetical protein [Aspergillus terreus NIH2624] Length = 446 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = -1 Query: 158 SEGYVPGQQAQQDMSRAADDLRSAMKGFGTNEGALIKVLAGLSPLQVNSVKA 3 S GY+PGQ A D R AD LR AMKGFGT+E ALI+VLA L PLQ+ +V++ Sbjct: 131 SRGYIPGQVAPGDFRREADALRKAMKGFGTDEKALIQVLAPLDPLQMAAVRS 182 >ref|XP_001275766.1| annexin ANXC3.2 [Aspergillus clavatus NRRL 1] gi|119403923|gb|EAW14340.1| annexin ANXC3.2 [Aspergillus clavatus NRRL 1] Length = 443 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/52 (63%), Positives = 39/52 (75%) Frame = -1 Query: 158 SEGYVPGQQAQQDMSRAADDLRSAMKGFGTNEGALIKVLAGLSPLQVNSVKA 3 S GYVPGQ A D R AD LR AMKGFGT+E ALI+VLA L PLQ+ +V++ Sbjct: 127 SMGYVPGQMAPGDFRREADLLRKAMKGFGTDEKALIQVLAKLDPLQMAAVRS 178 >tpe|CBF86831.1| TPA: annexin, putative (Eurofung) [Aspergillus nidulans FGSC A4] Length = 324 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -1 Query: 158 SEGYVPGQQAQQDMSRAADDLRSAMKGFGTNEGALIKVLAGLSPLQVNSVKA 3 S GY PGQ A D R AD LR AMKGFGT+E ALI+VL+ L PLQV +V+A Sbjct: 8 SLGYAPGQVAPGDFRREADALRKAMKGFGTDEKALIQVLSKLDPLQVAAVRA 59 >ref|XP_660031.1| hypothetical protein AN2427.2 [Aspergillus nidulans FGSC A4] gi|40744977|gb|EAA64133.1| hypothetical protein AN2427.2 [Aspergillus nidulans FGSC A4] Length = 417 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -1 Query: 158 SEGYVPGQQAQQDMSRAADDLRSAMKGFGTNEGALIKVLAGLSPLQVNSVKA 3 S GY PGQ A D R AD LR AMKGFGT+E ALI+VL+ L PLQV +V+A Sbjct: 101 SLGYAPGQVAPGDFRREADALRKAMKGFGTDEKALIQVLSKLDPLQVAAVRA 152 >gb|EPS33423.1| hypothetical protein PDE_08385 [Penicillium oxalicum 114-2] Length = 439 Score = 62.0 bits (149), Expect = 8e-08 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = -1 Query: 158 SEGYVPGQQAQQDMSRAADDLRSAMKGFGTNEGALIKVLAGLSPLQVNSVKA 3 S GY+PGQ A D AD LR AMKGFGT+E ALI+VLA L PLQ+ V+A Sbjct: 123 SPGYIPGQVAPGDFRAEADALRKAMKGFGTDEKALIQVLARLDPLQMAGVRA 174 >gb|EZF34726.1| hypothetical protein H101_01734 [Trichophyton interdigitale H6] Length = 452 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/47 (68%), Positives = 35/47 (74%) Frame = -1 Query: 158 SEGYVPGQQAQQDMSRAADDLRSAMKGFGTNEGALIKVLAGLSPLQV 18 S GYVPGQ AQ D SR AD LR AMKGFGT+E LI+VLA PLQ+ Sbjct: 136 SPGYVPGQMAQGDASREADTLRKAMKGFGTDELTLIEVLAKPDPLQM 182 >dbj|GAD96167.1| annexin ANXC3.2 [Byssochlamys spectabilis No. 5] Length = 446 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/52 (59%), Positives = 39/52 (75%) Frame = -1 Query: 158 SEGYVPGQQAQQDMSRAADDLRSAMKGFGTNEGALIKVLAGLSPLQVNSVKA 3 S GYVPGQ A D R AD LR AMKGFGT+E ALI+VL+ L PLQ+ ++++ Sbjct: 130 SLGYVPGQMAPGDFRRDADVLRKAMKGFGTDEAALIQVLSRLDPLQMAALRS 181 >gb|EGE08744.1| annexin A7 [Trichophyton equinum CBS 127.97] Length = 457 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/47 (68%), Positives = 35/47 (74%) Frame = -1 Query: 158 SEGYVPGQQAQQDMSRAADDLRSAMKGFGTNEGALIKVLAGLSPLQV 18 S GYVPGQ AQ D SR AD LR AMKGFGT+E LI+VLA PLQ+ Sbjct: 141 SPGYVPGQMAQGDASREADTLRKAMKGFGTDELTLIEVLAKPDPLQM 187 >gb|EGE00386.1| annexin [Trichophyton tonsurans CBS 112818] Length = 457 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/47 (68%), Positives = 35/47 (74%) Frame = -1 Query: 158 SEGYVPGQQAQQDMSRAADDLRSAMKGFGTNEGALIKVLAGLSPLQV 18 S GYVPGQ AQ D SR AD LR AMKGFGT+E LI+VLA PLQ+ Sbjct: 141 SPGYVPGQMAQGDASREADTLRKAMKGFGTDELTLIEVLAKPDPLQM 187 >ref|XP_003236627.1| annexin [Trichophyton rubrum CBS 118892] gi|326461969|gb|EGD87422.1| annexin [Trichophyton rubrum CBS 118892] gi|607869956|gb|EZF15213.1| hypothetical protein H100_05981 [Trichophyton rubrum MR850] gi|607902427|gb|EZF40007.1| hypothetical protein H102_05950 [Trichophyton rubrum CBS 100081] gi|607914552|gb|EZF50642.1| hypothetical protein H103_05976 [Trichophyton rubrum CBS 288.86] gi|607926432|gb|EZF61095.1| hypothetical protein H104_05963 [Trichophyton rubrum CBS 289.86] gi|607938510|gb|EZF71867.1| hypothetical protein H105_05990 [Trichophyton soudanense CBS 452.61] gi|607950565|gb|EZF82565.1| hypothetical protein H110_05972 [Trichophyton rubrum MR1448] gi|607962708|gb|EZF93237.1| hypothetical protein H113_06019 [Trichophyton rubrum MR1459] gi|607974885|gb|EZG04131.1| hypothetical protein H106_05813 [Trichophyton rubrum CBS 735.88] gi|607986777|gb|EZG14859.1| hypothetical protein H107_06112 [Trichophyton rubrum CBS 202.88] Length = 463 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/47 (68%), Positives = 35/47 (74%) Frame = -1 Query: 158 SEGYVPGQQAQQDMSRAADDLRSAMKGFGTNEGALIKVLAGLSPLQV 18 S GYVPGQ AQ D SR AD LR AMKGFGT+E LI+VLA PLQ+ Sbjct: 147 SPGYVPGQMAQGDASREADILRKAMKGFGTDELTLIEVLARPDPLQM 193 >ref|XP_003022577.1| annexin ANXC3.1 [Trichophyton verrucosum HKI 0517] gi|291186531|gb|EFE41959.1| annexin ANXC3.1 [Trichophyton verrucosum HKI 0517] Length = 423 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/47 (68%), Positives = 35/47 (74%) Frame = -1 Query: 158 SEGYVPGQQAQQDMSRAADDLRSAMKGFGTNEGALIKVLAGLSPLQV 18 S GYVPGQ AQ D SR AD LR AMKGFGT+E LI+VLA PLQ+ Sbjct: 107 SPGYVPGQMAQGDASREADILRKAMKGFGTDELTLIEVLARPDPLQM 153 >ref|XP_003013023.1| annexin ANXC3.1 [Arthroderma benhamiae CBS 112371] gi|291176585|gb|EFE32383.1| annexin ANXC3.1 [Arthroderma benhamiae CBS 112371] Length = 463 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/47 (68%), Positives = 35/47 (74%) Frame = -1 Query: 158 SEGYVPGQQAQQDMSRAADDLRSAMKGFGTNEGALIKVLAGLSPLQV 18 S GYVPGQ AQ D SR AD LR AMKGFGT+E LI+VLA PLQ+ Sbjct: 147 SPGYVPGQMAQGDASREADILRKAMKGFGTDELTLIEVLARPDPLQM 193 >ref|XP_001260847.1| annexin ANXC3.2 [Neosartorya fischeri NRRL 181] gi|119409001|gb|EAW18950.1| annexin ANXC3.2 [Neosartorya fischeri NRRL 181] Length = 446 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = -1 Query: 158 SEGYVPGQQAQQDMSRAADDLRSAMKGFGTNEGALIKVLAGLSPLQVNSVKA 3 S GYVPGQ A D R AD LR AMKGFGT+E LI+VL+ L PLQ+ +V++ Sbjct: 130 SLGYVPGQMAPGDFRREADLLRKAMKGFGTDEKTLIQVLSKLDPLQMAAVRS 181 >gb|EXJ64197.1| hypothetical protein A1O7_00533 [Cladophialophora yegresii CBS 114405] Length = 434 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = -1 Query: 158 SEGYVPGQQAQQDMSRAADDLRSAMKGFGTNEGALIKVLAGLSPLQV 18 S GY+PG AQ D SR AD LR+AMKGFGT+E ALI++L+ PLQ+ Sbjct: 116 SPGYIPGAAAQGDASRDADALRAAMKGFGTDESALIRILSKPDPLQM 162 >ref|XP_755722.1| annexin ANXC3.2 [Aspergillus fumigatus Af293] gi|47059733|gb|AAT09449.1| annexin ANXC3.2 [Aspergillus fumigatus] gi|66853360|gb|EAL93684.1| annexin ANXC3.2 [Aspergillus fumigatus Af293] gi|159129779|gb|EDP54893.1| annexin ANXC3.2 [Aspergillus fumigatus A1163] Length = 446 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = -1 Query: 158 SEGYVPGQQAQQDMSRAADDLRSAMKGFGTNEGALIKVLAGLSPLQVNSVKA 3 S GYVPGQ A D R AD LR AMKGFGT+E LI+VL+ L PLQ+ +V++ Sbjct: 130 SLGYVPGQMAPGDFRREADLLRKAMKGFGTDEKMLIQVLSKLDPLQMAAVRS 181 >gb|ETI28130.1| hypothetical protein G647_00579 [Cladophialophora carrionii CBS 160.54] Length = 436 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = -1 Query: 158 SEGYVPGQQAQQDMSRAADDLRSAMKGFGTNEGALIKVLAGLSPLQV 18 S GY+PG AQ D SR AD LR+AMKGFGT+E ALI++L+ PLQ+ Sbjct: 118 SPGYIPGAAAQGDASRDADALRAAMKGFGTDEAALIRILSKPDPLQM 164 >ref|XP_003174898.1| annexin A7 [Arthroderma gypseum CBS 118893] gi|311340213|gb|EFQ99415.1| annexin A7 [Arthroderma gypseum CBS 118893] Length = 457 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/47 (65%), Positives = 34/47 (72%) Frame = -1 Query: 158 SEGYVPGQQAQQDMSRAADDLRSAMKGFGTNEGALIKVLAGLSPLQV 18 S GY PGQ AQ D SR AD LR AMKGFGT+E LI+VLA PLQ+ Sbjct: 141 SPGYTPGQMAQGDASREADTLRKAMKGFGTDELTLIEVLAKPDPLQM 187 >gb|ETN39785.1| hypothetical protein HMPREF1541_06011 [Cyphellophora europaea CBS 101466] Length = 461 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/52 (59%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -1 Query: 158 SEGYVPGQQAQQ-DMSRAADDLRSAMKGFGTNEGALIKVLAGLSPLQVNSVK 6 S GY+PG AQ + ++AD LR+AMKGFGT+E LI+VL+ L PLQ+NSVK Sbjct: 145 SLGYIPGMTAQGWNADQSADALRAAMKGFGTDEKELIRVLSQLDPLQINSVK 196