BLASTX nr result
ID: Akebia27_contig00043885
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00043885 (383 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266598.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 emb|CAN68456.1| hypothetical protein VITISV_025676 [Vitis vinifera] 68 2e-09 emb|CAN77435.1| hypothetical protein VITISV_017817 [Vitis vinifera] 63 4e-08 ref|XP_004305093.1| PREDICTED: putative pentatricopeptide repeat... 63 5e-08 emb|CBI18084.3| unnamed protein product [Vitis vinifera] 63 5e-08 ref|XP_002265522.1| PREDICTED: putative pentatricopeptide repeat... 63 5e-08 gb|EEE56174.1| hypothetical protein OsJ_05117 [Oryza sativa Japo... 62 8e-08 gb|EEC72346.1| hypothetical protein OsI_05579 [Oryza sativa Indi... 62 8e-08 ref|XP_007207055.1| hypothetical protein PRUPE_ppb002198mg [Prun... 62 1e-07 ref|XP_004954764.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_003537434.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 ref|XP_002441722.1| hypothetical protein SORBIDRAFT_08g001305 [S... 59 7e-07 ref|XP_002270866.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|XP_006351545.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 gb|EMT09030.1| hypothetical protein F775_05194 [Aegilops tauschii] 58 2e-06 ref|XP_007163351.1| hypothetical protein PHAVU_001G227500g [Phas... 57 2e-06 ref|XP_004234342.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_002314110.1| pentatricopeptide repeat-containing family p... 57 2e-06 ref|XP_006443657.1| hypothetical protein CICLE_v10019256mg [Citr... 57 3e-06 gb|EXC31089.1| hypothetical protein L484_001076 [Morus notabilis] 57 4e-06 >ref|XP_002266598.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic [Vitis vinifera] gi|297742795|emb|CBI35475.3| unnamed protein product [Vitis vinifera] Length = 517 Score = 67.8 bits (164), Expect = 2e-09 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -1 Query: 383 KKPGCSWIEVNGVVHEFLAEDKMHRLSTEIYMVLDRIADQMK 258 KKPGCSW+EVNGVVHEFLAED +H + ++Y VL+ I +QMK Sbjct: 472 KKPGCSWVEVNGVVHEFLAEDAVHCIRADVYTVLEAITEQMK 513 >emb|CAN68456.1| hypothetical protein VITISV_025676 [Vitis vinifera] Length = 768 Score = 67.8 bits (164), Expect = 2e-09 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -1 Query: 383 KKPGCSWIEVNGVVHEFLAEDKMHRLSTEIYMVLDRIADQMK 258 KKPGCSW+EVNGVVHEFLAED +H + ++Y VL+ I +QMK Sbjct: 723 KKPGCSWVEVNGVVHEFLAEDAVHCIRADVYTVLEAITEQMK 764 >emb|CAN77435.1| hypothetical protein VITISV_017817 [Vitis vinifera] Length = 601 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -1 Query: 383 KKPGCSWIEVNGVVHEFLAEDKMHRLSTEIYMVLDRIADQMKL 255 K PGCSWIEVNGV+HEF+A DK H S +YM+L+ ++ Q+KL Sbjct: 542 KSPGCSWIEVNGVIHEFIAFDKSHTESINVYMMLESVSAQLKL 584 >ref|XP_004305093.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g08820-like [Fragaria vesca subsp. vesca] Length = 688 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/51 (56%), Positives = 34/51 (66%) Frame = -1 Query: 383 KKPGCSWIEVNGVVHEFLAEDKMHRLSTEIYMVLDRIADQMKLNSNLPGLD 231 K PGCSWIEVNGVVHEFL DK H LS +IY L+ +A +K +P D Sbjct: 552 KIPGCSWIEVNGVVHEFLVGDKSHELSDKIYAKLNELAKDLKAAGYIPTTD 602 >emb|CBI18084.3| unnamed protein product [Vitis vinifera] Length = 496 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/51 (54%), Positives = 35/51 (68%) Frame = -1 Query: 383 KKPGCSWIEVNGVVHEFLAEDKMHRLSTEIYMVLDRIADQMKLNSNLPGLD 231 K PGCSWIEV+G+VHEFL DK H LS +IY LD + +MK+ +P D Sbjct: 360 KPPGCSWIEVDGIVHEFLVGDKYHPLSEKIYAKLDELTKKMKVAGYVPTTD 410 >ref|XP_002265522.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g08820-like [Vitis vinifera] Length = 686 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/51 (54%), Positives = 35/51 (68%) Frame = -1 Query: 383 KKPGCSWIEVNGVVHEFLAEDKMHRLSTEIYMVLDRIADQMKLNSNLPGLD 231 K PGCSWIEV+G+VHEFL DK H LS +IY LD + +MK+ +P D Sbjct: 550 KPPGCSWIEVDGIVHEFLVGDKYHPLSEKIYAKLDELTKKMKVAGYVPTTD 600 >gb|EEE56174.1| hypothetical protein OsJ_05117 [Oryza sativa Japonica Group] Length = 545 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -1 Query: 383 KKPGCSWIEVNGVVHEFLAEDKMHRLSTEIYMVLDRIADQMKLN 252 KKPGCSWIEV+GVVHEFL EDK H EIY+ L+ +A +K++ Sbjct: 487 KKPGCSWIEVDGVVHEFLVEDKTHDARREIYVTLEIMARHLKMD 530 >gb|EEC72346.1| hypothetical protein OsI_05579 [Oryza sativa Indica Group] Length = 545 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -1 Query: 383 KKPGCSWIEVNGVVHEFLAEDKMHRLSTEIYMVLDRIADQMKLN 252 KKPGCSWIEV+GVVHEFL EDK H EIY+ L+ +A +K++ Sbjct: 487 KKPGCSWIEVDGVVHEFLVEDKSHDARREIYVTLEIMARHLKMD 530 >ref|XP_007207055.1| hypothetical protein PRUPE_ppb002198mg [Prunus persica] gi|462402697|gb|EMJ08254.1| hypothetical protein PRUPE_ppb002198mg [Prunus persica] Length = 636 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/51 (56%), Positives = 34/51 (66%) Frame = -1 Query: 383 KKPGCSWIEVNGVVHEFLAEDKMHRLSTEIYMVLDRIADQMKLNSNLPGLD 231 K PGCSWIEVNGVV EFL DK H LS +IY LD +A ++K +P D Sbjct: 500 KIPGCSWIEVNGVVQEFLVGDKSHALSEKIYAKLDELAKELKAAGYVPTTD 550 >ref|XP_004954764.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Setaria italica] Length = 452 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/44 (59%), Positives = 31/44 (70%) Frame = -1 Query: 383 KKPGCSWIEVNGVVHEFLAEDKMHRLSTEIYMVLDRIADQMKLN 252 KKPGCSWIEV+G VHEFL EDK H EIY L+ + Q K++ Sbjct: 397 KKPGCSWIEVDGAVHEFLVEDKTHHARREIYETLECMTRQFKMD 440 >ref|XP_003537434.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Glycine max] Length = 638 Score = 58.9 bits (141), Expect = 7e-07 Identities = 22/48 (45%), Positives = 36/48 (75%) Frame = -1 Query: 383 KKPGCSWIEVNGVVHEFLAEDKMHRLSTEIYMVLDRIADQMKLNSNLP 240 K PGCSWIE++GV+HEFL ED H + +I+ +L+ I++++ L ++P Sbjct: 502 KDPGCSWIEIDGVIHEFLVEDDSHSRAKDIHSMLEEISNKLSLEGHMP 549 >ref|XP_002441722.1| hypothetical protein SORBIDRAFT_08g001305 [Sorghum bicolor] gi|241942415|gb|EES15560.1| hypothetical protein SORBIDRAFT_08g001305 [Sorghum bicolor] Length = 528 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -1 Query: 383 KKPGCSWIEVNGVVHEFLAEDKMHRLSTEIYMVLDRIADQMK 258 KKPGCSWIE++G VHEFL EDK H EIY L+ ++ Q+K Sbjct: 481 KKPGCSWIEIDGAVHEFLVEDKTHDARREIYETLEYMSRQLK 522 >ref|XP_002270866.1| PREDICTED: pentatricopeptide repeat-containing protein At1g50270 [Vitis vinifera] gi|296089231|emb|CBI39003.3| unnamed protein product [Vitis vinifera] Length = 601 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/43 (58%), Positives = 31/43 (72%) Frame = -1 Query: 383 KKPGCSWIEVNGVVHEFLAEDKMHRLSTEIYMVLDRIADQMKL 255 K P CSWIEVNGV+HEF+A DK H S +YM+L + Q+KL Sbjct: 542 KSPACSWIEVNGVIHEFIAFDKSHIESINVYMMLGSVTAQLKL 584 >ref|XP_006351545.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Solanum tuberosum] Length = 533 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/46 (56%), Positives = 32/46 (69%) Frame = -1 Query: 383 KKPGCSWIEVNGVVHEFLAEDKMHRLSTEIYMVLDRIADQMKLNSN 246 KKPGCSWIE+NG++HEF+AE + IY VLD I Q KL +N Sbjct: 484 KKPGCSWIEINGILHEFMAEPSRQHVYDCIYRVLDTILKQSKLFTN 529 >gb|EMT09030.1| hypothetical protein F775_05194 [Aegilops tauschii] Length = 632 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = -1 Query: 383 KKPGCSWIEVNGVVHEFLAEDKMHRLSTEIYMVLDRIADQMKLN 252 KKPGCSWIEV+G VHEFL +DK H EIY L+ I Q+K++ Sbjct: 569 KKPGCSWIEVDGGVHEFLVQDKAHDARREIYDTLEGIDRQLKMD 612 >ref|XP_007163351.1| hypothetical protein PHAVU_001G227500g [Phaseolus vulgaris] gi|561036815|gb|ESW35345.1| hypothetical protein PHAVU_001G227500g [Phaseolus vulgaris] Length = 638 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/48 (45%), Positives = 35/48 (72%) Frame = -1 Query: 383 KKPGCSWIEVNGVVHEFLAEDKMHRLSTEIYMVLDRIADQMKLNSNLP 240 K PGCSWIE++GV+HEFL ED H + +I+ +L I++++ L ++P Sbjct: 502 KDPGCSWIEIDGVIHEFLVEDDSHPRAKDIHSMLKEISNKLSLEGHMP 549 >ref|XP_004234342.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Solanum lycopersicum] Length = 533 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/43 (58%), Positives = 30/43 (69%) Frame = -1 Query: 383 KKPGCSWIEVNGVVHEFLAEDKMHRLSTEIYMVLDRIADQMKL 255 KKPGCSWIE+NG++HEF+AE + IY VLD I Q KL Sbjct: 484 KKPGCSWIEINGILHEFMAEPSRQHVYDGIYRVLDTILKQSKL 526 >ref|XP_002314110.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222850518|gb|EEE88065.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 738 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = -1 Query: 383 KKPGCSWIEVNGVVHEFLAEDKMHRLSTEIYMVLDRIADQMK 258 K+PGCS IEVNG++HEFL D H LSTEIY LD I ++K Sbjct: 601 KEPGCSSIEVNGIIHEFLVGDNSHPLSTEIYSKLDEIVARIK 642 >ref|XP_006443657.1| hypothetical protein CICLE_v10019256mg [Citrus clementina] gi|568853066|ref|XP_006480188.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Citrus sinensis] gi|557545919|gb|ESR56897.1| hypothetical protein CICLE_v10019256mg [Citrus clementina] Length = 642 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/48 (47%), Positives = 34/48 (70%) Frame = -1 Query: 383 KKPGCSWIEVNGVVHEFLAEDKMHRLSTEIYMVLDRIADQMKLNSNLP 240 K PGCSWIE+NG++HEFL ED H + EI+ +L+ I+ ++ L+ P Sbjct: 506 KDPGCSWIELNGMIHEFLVEDDSHPKAKEIHSMLEEISSRLSLSGYRP 553 >gb|EXC31089.1| hypothetical protein L484_001076 [Morus notabilis] Length = 625 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/51 (52%), Positives = 33/51 (64%) Frame = -1 Query: 383 KKPGCSWIEVNGVVHEFLAEDKMHRLSTEIYMVLDRIADQMKLNSNLPGLD 231 K+PGCS IEVN +HEFLA DK H S +IY +L+ I D +K N P D Sbjct: 489 KEPGCSSIEVNNKIHEFLAGDKRHPKSKQIYKMLEEINDWLKANGYTPQTD 539