BLASTX nr result
ID: Akebia27_contig00043803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00043803 (390 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007583072.1| hypothetical protein UCRNP2_3781 [Neofusicoc... 59 7e-07 >ref|XP_007583072.1| hypothetical protein UCRNP2_3781 [Neofusicoccum parvum UCRNP2] gi|485924725|gb|EOD49467.1| hypothetical protein UCRNP2_3781 [Neofusicoccum parvum UCRNP2] Length = 247 Score = 58.9 bits (141), Expect = 7e-07 Identities = 33/72 (45%), Positives = 45/72 (62%), Gaps = 1/72 (1%) Frame = +3 Query: 3 CVDVTLAADDDPDIQRVTDDNCYNSTKKKSRIGFNLVFATSSLNAAPTLFP-SSILTLLP 179 CVD+T A + D+ V + NC N+T S I F+LVFAT+ L++A TL P SS++ LP Sbjct: 178 CVDITFA--EPQDVAEVNETNCKNTTDSDSLITFDLVFATTDLSSASTLLPASSLMAALP 235 Query: 180 LVAAFVASFAWL 215 AA V +F L Sbjct: 236 TAAALVFAFFML 247