BLASTX nr result
ID: Akebia27_contig00043693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00043693 (443 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC96336.1| hypothetical protein BAUCODRAFT_147964 [Baudoinia... 60 4e-07 >gb|EMC96336.1| hypothetical protein BAUCODRAFT_147964 [Baudoinia compniacensis UAMH 10762] Length = 75 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/66 (43%), Positives = 40/66 (60%) Frame = +1 Query: 103 KAKEIASGEGGPKKPEAPALREQSASGDKMENQLEMQKENKQHVDSPDQVAGRKEKGSMT 282 KA E+AS GG ++ + R+ +A +MEN LEM K NK VAGRK+KG+ T Sbjct: 5 KADEVASSAGGQQQDRSSTARKTAAGDGRMENSLEMNKANKVETTEASDVAGRKDKGTGT 64 Query: 283 GLLEKI 300 G +EK+ Sbjct: 65 GRIEKL 70