BLASTX nr result
ID: Akebia27_contig00043597
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00043597 (393 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON66567.1| hypothetical protein W97_05812 [Coniosporium apol... 64 3e-08 ref|XP_001931332.1| conserved hypothetical protein [Pyrenophora ... 55 8e-06 >gb|EON66567.1| hypothetical protein W97_05812 [Coniosporium apollinis CBS 100218] Length = 169 Score = 63.5 bits (153), Expect = 3e-08 Identities = 45/129 (34%), Positives = 67/129 (51%), Gaps = 23/129 (17%) Frame = +2 Query: 68 ADTSPASRTEASNTSPERATALLAKMASNPGS-RRHSPNHSPLPSP--GERSPDENRTLA 238 A+TS R +A + +P +AT LL+++AS+P S R SP SPLP P G + D++ T Sbjct: 40 ANTSSVPRQDAGSHTPTKATVLLSRVASHPASPRASSPPTSPLPRPPGGHQYADDSST-- 97 Query: 239 PYGGNRLGSESGRKQILRDFNS--CGQR------------------DGYISFPDFERYRQ 358 S R ++ R + + CG++ DGY+SFPDFE++RQ Sbjct: 98 -------PSRQSRPEMARCWTTGTCGKQGAPLQPTQAMLETNVLDSDGYVSFPDFEQFRQ 150 Query: 359 GCEAGGGQE 385 EA G+E Sbjct: 151 RSEAYAGRE 159 >ref|XP_001931332.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330944269|ref|XP_003306347.1| hypothetical protein PTT_19477 [Pyrenophora teres f. teres 0-1] gi|187972938|gb|EDU40437.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311316197|gb|EFQ85580.1| hypothetical protein PTT_19477 [Pyrenophora teres f. teres 0-1] Length = 147 Score = 55.5 bits (132), Expect = 8e-06 Identities = 38/102 (37%), Positives = 57/102 (55%), Gaps = 2/102 (1%) Frame = +2 Query: 89 RTEASNTSPERATALLAKMASNPGSRR-HSPNHSPLPSPGERSPDENRTLAPYGGNRLG- 262 R A++ SP +A+ LLAK+AS+P + R +P SP+ +P R E Y R Sbjct: 48 RDSATSGSPHKASILLAKVASSPTTPRGETPPGSPMLAPRSRLNSE----PAYSAERPAM 103 Query: 263 SESGRKQILRDFNSCGQRDGYISFPDFERYRQGCEAGGGQER 388 S + + +R + Q+DGYISFPDFE++ Q + G QE+ Sbjct: 104 SRTESDRYVRQYR---QQDGYISFPDFEKFCQNQDVYGQQEQ 142