BLASTX nr result
ID: Akebia27_contig00043568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00043568 (583 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS87997.1| hypothetical protein PFICI_01825 [Pestalotiopsis ... 56 6e-06 >gb|ETS87997.1| hypothetical protein PFICI_01825 [Pestalotiopsis fici W106-1] Length = 528 Score = 56.2 bits (134), Expect = 6e-06 Identities = 31/66 (46%), Positives = 38/66 (57%), Gaps = 7/66 (10%) Frame = -3 Query: 581 MDIIDDADNAFGMM-------PQGDTDYQSFGKVLFQVASEVPGXXXXXXXXXXXXXXLA 423 M++ID +++ + MM PQ + DYQSFGKVLFQVASEVPG Sbjct: 463 MNLIDSSESGYDMMAATQQSHPQNEHDYQSFGKVLFQVASEVPGSSGSEYSSDESGDISG 522 Query: 422 KKRKRS 405 KKRKRS Sbjct: 523 KKRKRS 528