BLASTX nr result
ID: Akebia27_contig00042811
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00042811 (496 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS43841.1| hypothetical protein H072_2126 [Dactylellina hapt... 64 2e-08 gb|EGX43646.1| hypothetical protein AOL_s00215g382 [Arthrobotrys... 64 2e-08 >gb|EPS43841.1| hypothetical protein H072_2126 [Dactylellina haptotyla CBS 200.50] Length = 66 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/62 (53%), Positives = 40/62 (64%), Gaps = 2/62 (3%) Frame = -3 Query: 416 FRNTHVTFTDDAGKDVVGIVKSFGSGKYSIQTKNSDTVSVDEGKVSELKV--TDPGACPV 243 + THVTFT+ +G + VGIV+S+ G YSIQ K+ VSV EG V ELKV T CPV Sbjct: 3 YPGTHVTFTNSSGGEEVGIVQSYNDGTYSIQVKSKSIVSVSEGSVKELKVSATQKDNCPV 62 Query: 242 AG 237 G Sbjct: 63 VG 64 >gb|EGX43646.1| hypothetical protein AOL_s00215g382 [Arthrobotrys oligospora ATCC 24927] Length = 67 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/59 (54%), Positives = 39/59 (66%), Gaps = 2/59 (3%) Frame = -3 Query: 407 THVTFTDDAGKDVVGIVKSFGSGKYSIQTKNSDTVSVDEGKVSELKVT--DPGACPVAG 237 THVTFT+ G + VG+V+S G+Y+IQ KN TV+V EG V ELKVT CPV G Sbjct: 7 THVTFTNSTGGEEVGVVQSHSGGQYTIQRKNGSTVTVSEGSVKELKVTSGQKDNCPVVG 65