BLASTX nr result
ID: Akebia27_contig00042788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00042788 (377 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007018078.1| Pentatricopeptide repeat (PPR) superfamily p... 65 1e-08 ref|XP_006279800.1| hypothetical protein CARUB_v10027962mg [Caps... 61 2e-07 emb|CAN84084.1| hypothetical protein VITISV_018999 [Vitis vinifera] 60 2e-07 emb|CBI40732.3| unnamed protein product [Vitis vinifera] 60 4e-07 ref|NP_199195.4| pentatricopeptide repeat-containing protein [Ar... 59 9e-07 ref|XP_002510695.1| pentatricopeptide repeat-containing protein,... 59 9e-07 gb|EYU43538.1| hypothetical protein MIMGU_mgv1a024877mg [Mimulus... 58 1e-06 ref|XP_006403177.1| hypothetical protein EUTSA_v10003177mg [Eutr... 58 2e-06 gb|EPS70746.1| hypothetical protein M569_04016, partial [Genlise... 57 3e-06 ref|XP_006855725.1| hypothetical protein AMTR_s00044p00153760 [A... 56 4e-06 ref|XP_007158555.1| hypothetical protein PHAVU_002G162200g [Phas... 56 6e-06 ref|XP_007210680.1| hypothetical protein PRUPE_ppa023340mg [Prun... 55 1e-05 >ref|XP_007018078.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590595518|ref|XP_007018079.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590595521|ref|XP_007018080.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590595525|ref|XP_007018081.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508723406|gb|EOY15303.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508723407|gb|EOY15304.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508723408|gb|EOY15305.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508723409|gb|EOY15306.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] Length = 562 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/46 (63%), Positives = 32/46 (69%) Frame = -3 Query: 375 VIYGXXXXXXXXXXKVEMAYKLFLKVKKARRSENARRYWRANGWHF 238 V+Y +VE AYKLFLK+K ARR ENARRYWRANGWHF Sbjct: 517 VLYSKLNNKLLASNEVEKAYKLFLKIKNARRDENARRYWRANGWHF 562 >ref|XP_006279800.1| hypothetical protein CARUB_v10027962mg [Capsella rubella] gi|482548504|gb|EOA12698.1| hypothetical protein CARUB_v10027962mg [Capsella rubella] Length = 547 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 327 EMAYKLFLKVKKARRSENARRYWRANGWHF 238 E+AYKLFLK+KKAR +ENARR+WR+NGWHF Sbjct: 518 ELAYKLFLKIKKARATENARRFWRSNGWHF 547 >emb|CAN84084.1| hypothetical protein VITISV_018999 [Vitis vinifera] Length = 561 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 330 VEMAYKLFLKVKKARRSENARRYWRANGWHF 238 VEMAYKLFLK+K AR+++NARR+WR NGWHF Sbjct: 531 VEMAYKLFLKIKXARQNDNARRFWRGNGWHF 561 >emb|CBI40732.3| unnamed protein product [Vitis vinifera] Length = 520 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 330 VEMAYKLFLKVKKARRSENARRYWRANGWHF 238 VEMAYKLFLK+K AR+++NARR+WR NGWHF Sbjct: 490 VEMAYKLFLKIKIARQNDNARRFWRGNGWHF 520 >ref|NP_199195.4| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635652|sp|P0C8R0.1|PP416_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At5g43820 gi|332007631|gb|AED95014.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 546 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -3 Query: 327 EMAYKLFLKVKKARRSENARRYWRANGWHF 238 E+AYKLFLK+KKAR +ENAR +WR+NGWHF Sbjct: 517 ELAYKLFLKIKKARATENARSFWRSNGWHF 546 >ref|XP_002510695.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223551396|gb|EEF52882.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 195 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = -3 Query: 375 VIYGXXXXXXXXXXKVEMAYKLFLKVKKARRSENARRYWRANGWHF 238 +IY KVE AYKL+LKV+ AR +ENARR+WRANGWHF Sbjct: 150 LIYSKLNNKLLASSKVERAYKLYLKVRDARSNENARRFWRANGWHF 195 >gb|EYU43538.1| hypothetical protein MIMGU_mgv1a024877mg [Mimulus guttatus] Length = 553 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 330 VEMAYKLFLKVKKARRSENARRYWRANGWHF 238 VE+AYKLFLK++KAR +ENA+RYWRA GWHF Sbjct: 523 VEVAYKLFLKLRKARVNENAQRYWRAKGWHF 553 >ref|XP_006403177.1| hypothetical protein EUTSA_v10003177mg [Eutrema salsugineum] gi|557104290|gb|ESQ44630.1| hypothetical protein EUTSA_v10003177mg [Eutrema salsugineum] Length = 541 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 327 EMAYKLFLKVKKARRSENARRYWRANGWHF 238 EMAYKLFLK+K+AR +NARR+WR NGWHF Sbjct: 512 EMAYKLFLKIKEARLKDNARRFWRRNGWHF 541 >gb|EPS70746.1| hypothetical protein M569_04016, partial [Genlisea aurea] Length = 471 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 330 VEMAYKLFLKVKKARRSENARRYWRANGWHF 238 VE+AYKLFLK++ AR ENARRYWR+ GWHF Sbjct: 441 VEIAYKLFLKLRNARAEENARRYWRSKGWHF 471 >ref|XP_006855725.1| hypothetical protein AMTR_s00044p00153760 [Amborella trichopoda] gi|548859512|gb|ERN17192.1| hypothetical protein AMTR_s00044p00153760 [Amborella trichopoda] Length = 413 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = -3 Query: 375 VIYGXXXXXXXXXXKVEMAYKLFLKVKKARRSENARRYWRANGWHF 238 VIY KVE+AYKL++K+K+ARR+E +R+YW ANGWHF Sbjct: 368 VIYSKLNCKLLDASKVELAYKLYVKIKEARRNELSRKYWFANGWHF 413 >ref|XP_007158555.1| hypothetical protein PHAVU_002G162200g [Phaseolus vulgaris] gi|561031970|gb|ESW30549.1| hypothetical protein PHAVU_002G162200g [Phaseolus vulgaris] Length = 549 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -3 Query: 327 EMAYKLFLKVKKARRSENARRYWRANGWHF 238 E AYKLFLK+K AR ENAR YWR+NGWHF Sbjct: 520 ERAYKLFLKIKHARSLENARNYWRSNGWHF 549 >ref|XP_007210680.1| hypothetical protein PRUPE_ppa023340mg [Prunus persica] gi|462406415|gb|EMJ11879.1| hypothetical protein PRUPE_ppa023340mg [Prunus persica] Length = 562 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -3 Query: 330 VEMAYKLFLKVKKARRSENARRYWRANGWHF 238 VE AYKLFLK+K ARR +NA+R+WR+ GWHF Sbjct: 532 VERAYKLFLKIKHARRYDNAQRFWRSKGWHF 562