BLASTX nr result
ID: Akebia27_contig00041950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00041950 (424 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS76994.1| hypothetical protein PFICI_10868 [Pestalotiopsis ... 64 3e-08 gb|EFQ27987.1| hypothetical protein GLRG_03131 [Colletotrichum g... 63 5e-08 gb|ENH88211.1| hypothetical protein Cob_03114 [Colletotrichum or... 60 2e-07 emb|CCF37129.1| hypothetical protein CH063_08543 [Colletotrichum... 59 5e-07 ref|XP_007599195.1| hypothetical protein CFIO01_13089 [Colletotr... 58 2e-06 >gb|ETS76994.1| hypothetical protein PFICI_10868 [Pestalotiopsis fici W106-1] Length = 580 Score = 63.5 bits (153), Expect = 3e-08 Identities = 35/55 (63%), Positives = 42/55 (76%), Gaps = 3/55 (5%) Frame = +1 Query: 1 PARTPVTESSHFSQLSPFLDPPPSRDPLGRSRASQDGS---NRSHGSASRFTEEI 156 PAR P+TE+S+F+ +P L PPP RDP+GRS AS DGS + SHGS SRFTEEI Sbjct: 529 PARMPITEASYFA--APSLSPPP-RDPVGRSHASADGSSIYDPSHGSGSRFTEEI 580 >gb|EFQ27987.1| hypothetical protein GLRG_03131 [Colletotrichum graminicola M1.001] Length = 527 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/56 (58%), Positives = 41/56 (73%), Gaps = 4/56 (7%) Frame = +1 Query: 1 PARTPVTESSHF----SQLSPFLDPPPSRDPLGRSRASQDGSNRSHGSASRFTEEI 156 PARTPVTES+ F + LSP PPP+RDP+GR+ SQDGS S GSAS+F E++ Sbjct: 474 PARTPVTESAPFGDPNASLSP--SPPPARDPIGRTMPSQDGSRDSRGSASKFQEQM 527 >gb|ENH88211.1| hypothetical protein Cob_03114 [Colletotrichum orbiculare MAFF 240422] Length = 523 Score = 60.5 bits (145), Expect = 2e-07 Identities = 34/57 (59%), Positives = 40/57 (70%), Gaps = 5/57 (8%) Frame = +1 Query: 1 PARTPVTESSHFSQL-----SPFLDPPPSRDPLGRSRASQDGSNRSHGSASRFTEEI 156 PARTPVTES+ FS SP PP+RDP+GR+ SQDGS S GSASRFTE++ Sbjct: 469 PARTPVTESAPFSAPPDGAHSPL--EPPTRDPIGRTLRSQDGSRGSRGSASRFTEDM 523 >emb|CCF37129.1| hypothetical protein CH063_08543 [Colletotrichum higginsianum] Length = 531 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/54 (57%), Positives = 37/54 (68%), Gaps = 2/54 (3%) Frame = +1 Query: 1 PARTPVTESSHFSQLSPFLDP--PPSRDPLGRSRASQDGSNRSHGSASRFTEEI 156 PARTPVTES+ FS P PP+RDP+GR+ SQDGS S GS SRF E++ Sbjct: 478 PARTPVTESAPFSDQDNSFVPLAPPARDPIGRTLPSQDGSRGSRGSGSRFHEDM 531 >ref|XP_007599195.1| hypothetical protein CFIO01_13089 [Colletotrichum fioriniae PJ7] gi|588895451|gb|EXF77163.1| hypothetical protein CFIO01_13089 [Colletotrichum fioriniae PJ7] Length = 544 Score = 57.8 bits (138), Expect = 2e-06 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 8/60 (13%) Frame = +1 Query: 1 PARTPVTESSHFSQ--LSPFLDPP------PSRDPLGRSRASQDGSNRSHGSASRFTEEI 156 PARTPVTES+ F SP +PP P RDP+GR+ SQDGS S GSASRF E++ Sbjct: 485 PARTPVTESAPFPPPAASPQTNPPFVPLQPPGRDPIGRTLPSQDGSRGSRGSASRFHEDM 544