BLASTX nr result
ID: Akebia27_contig00041833
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00041833 (420 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR13316.1| putative ribosomal protein L36 [Prunus dulcis] 50 3e-07 >gb|ABR13316.1| putative ribosomal protein L36 [Prunus dulcis] Length = 79 Score = 49.7 bits (117), Expect(2) = 3e-07 Identities = 24/40 (60%), Positives = 27/40 (67%) Frame = +1 Query: 157 LENPFFSLFIPQVGTNYYNLSPLMDQSTFFPNFYEQRPLF 276 LE SLF+ +VGTNYYN SP DQSTFF NF + P F Sbjct: 13 LERLALSLFMSRVGTNYYNSSPPTDQSTFFTNFTNRGPYF 52 Score = 30.4 bits (67), Expect(2) = 3e-07 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +2 Query: 254 FMNRGPYFRICHS 292 F NRGPYF ICHS Sbjct: 45 FTNRGPYFHICHS 57