BLASTX nr result
ID: Akebia27_contig00041516
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00041516 (513 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007587165.1| hypothetical protein UCRNP2_7918 [Neofusicoc... 77 2e-12 gb|EME40982.1| hypothetical protein DOTSEDRAFT_74511 [Dothistrom... 75 7e-12 ref|XP_003849309.1| hypothetical protein MYCGRDRAFT_105661 [Zymo... 73 4e-11 gb|EMC91747.1| hypothetical protein BAUCODRAFT_38884 [Baudoinia ... 73 5e-11 ref|XP_001797419.1| hypothetical protein SNOG_07065 [Phaeosphaer... 72 1e-10 gb|EON61188.1| hypothetical protein W97_00400 [Coniosporium apol... 71 1e-10 gb|EMR90872.1| putative allergen protein [Botryotinia fuckeliana... 70 2e-10 gb|EHK96035.1| hypothetical protein M7I_8279 [Glarea lozoyensis ... 70 2e-10 ref|XP_001551198.1| hypothetical protein BC1G_10113 [Botryotinia... 70 2e-10 gb|ESZ93835.1| hypothetical protein SBOR_5776 [Sclerotinia borea... 70 4e-10 ref|XP_001585187.1| hypothetical protein SS1G_13755 [Sclerotinia... 69 7e-10 gb|EME78397.1| hypothetical protein MYCFIDRAFT_36799 [Pseudocerc... 66 4e-09 ref|XP_003306179.1| hypothetical protein PTT_19262 [Pyrenophora ... 65 7e-09 ref|XP_001931107.1| hypothetical protein PTRG_00774 [Pyrenophora... 65 7e-09 gb|EUN29725.1| hypothetical protein COCVIDRAFT_13641 [Bipolaris ... 65 1e-08 gb|EUC50137.1| hypothetical protein COCMIDRAFT_82508 [Bipolaris ... 65 1e-08 gb|EUC30008.1| hypothetical protein COCCADRAFT_39694 [Bipolaris ... 65 1e-08 gb|ENI08565.1| hypothetical protein COCC4DRAFT_188030 [Bipolaris... 65 1e-08 gb|EMD91678.1| hypothetical protein COCHEDRAFT_1136481 [Bipolari... 65 1e-08 gb|EMD61453.1| hypothetical protein COCSADRAFT_148210 [Bipolaris... 65 1e-08 >ref|XP_007587165.1| hypothetical protein UCRNP2_7918 [Neofusicoccum parvum UCRNP2] gi|485918825|gb|EOD45357.1| hypothetical protein UCRNP2_7918 [Neofusicoccum parvum UCRNP2] Length = 361 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = -1 Query: 450 NPAQHHSSSTLPAVSLHEFKNRGGVLGGREERYDAFEGEPKNIGG 316 N AQHHSSS LPAVS+ +FK +GGVL GREERYD FEGEP+NIGG Sbjct: 133 NAAQHHSSSALPAVSMADFKKQGGVLTGREERYDGFEGEPRNIGG 177 >gb|EME40982.1| hypothetical protein DOTSEDRAFT_74511 [Dothistroma septosporum NZE10] Length = 289 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = -1 Query: 450 NPAQHHSSSTLPAVSLHEFKNRGGVLGGREERYDAFEGEPKNIGGFAQG 304 N AQHH++S LPAVS+ +FK +GGVL GREERYD FEGEP+++GG A G Sbjct: 162 NSAQHHATSALPAVSMADFKKQGGVLSGREERYDGFEGEPRSLGGNATG 210 >ref|XP_003849309.1| hypothetical protein MYCGRDRAFT_105661 [Zymoseptoria tritici IPO323] gi|339469186|gb|EGP84285.1| hypothetical protein MYCGRDRAFT_105661 [Zymoseptoria tritici IPO323] Length = 263 Score = 73.2 bits (178), Expect = 4e-11 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = -1 Query: 450 NPAQHHSSSTLPAVSLHEFKNRGGVLGGREERYDAFEGEPKNIGGFAQG 304 N AQHH++S LP VS+ E+K +GGVL GREERYD FEGEP+++GG A G Sbjct: 162 NAAQHHATSELPPVSMSEYKKQGGVLTGREERYDGFEGEPRSVGGAALG 210 >gb|EMC91747.1| hypothetical protein BAUCODRAFT_38884 [Baudoinia compniacensis UAMH 10762] Length = 274 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = -1 Query: 450 NPAQHHSSSTLPAVSLHEFKNRGGVLGGREERYDAFEGEPKNIGGFAQG 304 N AQHH++S LPAVS+ +FK +GGVL GREERYD F+GEP+ IGG G Sbjct: 162 NAAQHHATSALPAVSMQDFKKQGGVLSGREERYDGFQGEPRAIGGALGG 210 >ref|XP_001797419.1| hypothetical protein SNOG_07065 [Phaeosphaeria nodorum SN15] gi|111064596|gb|EAT85716.1| hypothetical protein SNOG_07065 [Phaeosphaeria nodorum SN15] Length = 301 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = -1 Query: 450 NPAQHHSSSTLPAVSLHEFKNRGGVLGGREERYDAFEGEPKNIGGFAQG 304 N A HH ++ LPA+++ +FKN+GGVL GREERYD FEG PKNIGG G Sbjct: 162 NAATHHETTALPAMTMDQFKNKGGVLSGREERYDEFEGVPKNIGGGTAG 210 >gb|EON61188.1| hypothetical protein W97_00400 [Coniosporium apollinis CBS 100218] Length = 327 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/49 (63%), Positives = 40/49 (81%) Frame = -1 Query: 450 NPAQHHSSSTLPAVSLHEFKNRGGVLGGREERYDAFEGEPKNIGGFAQG 304 N AQ+H++S LPAVS+ +FK +GGVL GREERYD FEGEP+++GG G Sbjct: 162 NAAQYHTTSALPAVSMADFKKQGGVLTGREERYDGFEGEPRSVGGALTG 210 >gb|EMR90872.1| putative allergen protein [Botryotinia fuckeliana BcDW1] Length = 304 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/50 (60%), Positives = 42/50 (84%) Frame = -1 Query: 450 NPAQHHSSSTLPAVSLHEFKNRGGVLGGREERYDAFEGEPKNIGGFAQGE 301 N A+HH+++ LPAVS+ EF+++GG LGGREER DAF+GEPK++GG G+ Sbjct: 162 NEAKHHTATALPAVSMSEFRSQGGSLGGREERTDAFKGEPKSVGGTLGGD 211 >gb|EHK96035.1| hypothetical protein M7I_8279 [Glarea lozoyensis 74030] gi|512206392|gb|EPE35212.1| hypothetical protein GLAREA_10909 [Glarea lozoyensis ATCC 20868] Length = 334 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/50 (62%), Positives = 42/50 (84%) Frame = -1 Query: 450 NPAQHHSSSTLPAVSLHEFKNRGGVLGGREERYDAFEGEPKNIGGFAQGE 301 N A+HH+++ LPAVSL EFK++GG LGGREER DAF+GEP+++GG G+ Sbjct: 162 NEAKHHTATQLPAVSLSEFKSQGGHLGGREERTDAFQGEPRSVGGTLGGK 211 >ref|XP_001551198.1| hypothetical protein BC1G_10113 [Botryotinia fuckeliana B05.10] gi|347440696|emb|CCD33617.1| hypothetical protein BofuT4_P068330.1 [Botryotinia fuckeliana T4] Length = 300 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/50 (60%), Positives = 42/50 (84%) Frame = -1 Query: 450 NPAQHHSSSTLPAVSLHEFKNRGGVLGGREERYDAFEGEPKNIGGFAQGE 301 N A+HH+++ LPAVS+ EF+++GG LGGREER DAF+GEPK++GG G+ Sbjct: 162 NEAKHHTATALPAVSMSEFRSQGGSLGGREERTDAFKGEPKSVGGTLGGD 211 >gb|ESZ93835.1| hypothetical protein SBOR_5776 [Sclerotinia borealis F-4157] Length = 304 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/49 (61%), Positives = 40/49 (81%) Frame = -1 Query: 450 NPAQHHSSSTLPAVSLHEFKNRGGVLGGREERYDAFEGEPKNIGGFAQG 304 N A+HHS++ LPAVS++EF+ +GG LGGR+ER DAF GEPK++GG G Sbjct: 162 NEAKHHSATALPAVSMNEFRQQGGALGGRKERTDAFAGEPKSVGGTLGG 210 >ref|XP_001585187.1| hypothetical protein SS1G_13755 [Sclerotinia sclerotiorum 1980] gi|154699158|gb|EDN98896.1| hypothetical protein SS1G_13755 [Sclerotinia sclerotiorum 1980 UF-70] Length = 289 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/49 (59%), Positives = 41/49 (83%) Frame = -1 Query: 450 NPAQHHSSSTLPAVSLHEFKNRGGVLGGREERYDAFEGEPKNIGGFAQG 304 N +HH++++LPAVS+ EF+++GG LGGREER DAF+GEPK++GG G Sbjct: 162 NEPKHHTATSLPAVSMDEFRHQGGALGGREERTDAFKGEPKSVGGTLGG 210 >gb|EME78397.1| hypothetical protein MYCFIDRAFT_36799 [Pseudocercospora fijiensis CIRAD86] Length = 215 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = -1 Query: 450 NPAQHHSSSTLPAVSLHEFKNRGGVLGGREERYDAFEGEPKNIGGFAQGE 301 N A +H+ STLPA++L EF GGVL GREERYDAFEGEP+++G +G+ Sbjct: 162 NRAIYHAPSTLPALTLAEFLKNGGVLNGREERYDAFEGEPRSVGEALRGD 211 >ref|XP_003306179.1| hypothetical protein PTT_19262 [Pyrenophora teres f. teres 0-1] gi|311316412|gb|EFQ85721.1| hypothetical protein PTT_19262 [Pyrenophora teres f. teres 0-1] Length = 422 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -1 Query: 450 NPAQHHSSSTLPAVSLHEFKNRGGVLGGREERYDAFEGEPKNIGG 316 N A HH ++ LPA+++ +FK +GG L GREERYD FEG PKNIGG Sbjct: 162 NKATHHETTALPAMTMDQFKAKGGALTGREERYDEFEGVPKNIGG 206 >ref|XP_001931107.1| hypothetical protein PTRG_00774 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187972713|gb|EDU40212.1| hypothetical protein PTRG_00774 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 420 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -1 Query: 450 NPAQHHSSSTLPAVSLHEFKNRGGVLGGREERYDAFEGEPKNIGG 316 N A HH ++ LPA+++ +FK +GG L GREERYD FEG PKNIGG Sbjct: 162 NKATHHETTALPAMTMDQFKAKGGALTGREERYDEFEGVPKNIGG 206 >gb|EUN29725.1| hypothetical protein COCVIDRAFT_13641 [Bipolaris victoriae FI3] Length = 434 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -1 Query: 450 NPAQHHSSSTLPAVSLHEFKNRGGVLGGREERYDAFEGEPKNIGG 316 N A HH ++ LPA+++ +FK +GG L GREERYD FEG PKNIGG Sbjct: 162 NKATHHETTALPAMTMEQFKAKGGSLTGREERYDEFEGVPKNIGG 206 >gb|EUC50137.1| hypothetical protein COCMIDRAFT_82508 [Bipolaris oryzae ATCC 44560] Length = 403 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -1 Query: 450 NPAQHHSSSTLPAVSLHEFKNRGGVLGGREERYDAFEGEPKNIGG 316 N A HH ++ LPA+++ +FK +GG L GREERYD FEG PKNIGG Sbjct: 162 NKATHHETTALPAMTMEQFKAKGGSLTGREERYDEFEGVPKNIGG 206 >gb|EUC30008.1| hypothetical protein COCCADRAFT_39694 [Bipolaris zeicola 26-R-13] Length = 438 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -1 Query: 450 NPAQHHSSSTLPAVSLHEFKNRGGVLGGREERYDAFEGEPKNIGG 316 N A HH ++ LPA+++ +FK +GG L GREERYD FEG PKNIGG Sbjct: 162 NKATHHETTALPAMTMEQFKAKGGSLTGREERYDEFEGVPKNIGG 206 >gb|ENI08565.1| hypothetical protein COCC4DRAFT_188030 [Bipolaris maydis ATCC 48331] Length = 374 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -1 Query: 450 NPAQHHSSSTLPAVSLHEFKNRGGVLGGREERYDAFEGEPKNIGG 316 N A HH ++ LPA+++ +FK +GG L GREERYD FEG PKNIGG Sbjct: 162 NKATHHETTALPAMTMEQFKAKGGSLTGREERYDEFEGVPKNIGG 206 >gb|EMD91678.1| hypothetical protein COCHEDRAFT_1136481 [Bipolaris maydis C5] Length = 473 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -1 Query: 450 NPAQHHSSSTLPAVSLHEFKNRGGVLGGREERYDAFEGEPKNIGG 316 N A HH ++ LPA+++ +FK +GG L GREERYD FEG PKNIGG Sbjct: 162 NKATHHETTALPAMTMEQFKAKGGSLTGREERYDEFEGVPKNIGG 206 >gb|EMD61453.1| hypothetical protein COCSADRAFT_148210 [Bipolaris sorokiniana ND90Pr] Length = 437 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -1 Query: 450 NPAQHHSSSTLPAVSLHEFKNRGGVLGGREERYDAFEGEPKNIGG 316 N A HH ++ LPA+++ +FK +GG L GREERYD FEG PKNIGG Sbjct: 162 NKATHHETTALPAMTMEQFKAKGGSLTGREERYDEFEGVPKNIGG 206