BLASTX nr result
ID: Akebia27_contig00041310
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00041310 (375 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA20876.1| pepsinogen [Aspergillus niger] gi|350634685|gb|EH... 87 3e-15 gb|EKG17726.1| Peptidase A1 [Macrophomina phaseolina MS6] 87 3e-15 dbj|GAA88863.1| aspartic protease (PepE) [Aspergillus kawachii I... 87 3e-15 ref|XP_002143541.1| aspartic endopeptidase Pep2 [Talaromyces mar... 87 3e-15 ref|XP_001399855.1| vacuolar protease A [Aspergillus niger CBS 5... 87 3e-15 ref|XP_001819842.1| vacuolar protease A [Aspergillus oryzae RIB4... 86 4e-15 ref|XP_002479865.1| aspartic endopeptidase Pep2 [Talaromyces sti... 86 4e-15 ref|XP_001213854.1| vacuolar protease A precursor [Aspergillus t... 86 4e-15 ref|XP_660507.1| hypothetical protein AN2903.2 [Aspergillus nidu... 86 4e-15 emb|CDM30585.1| Vacuolar protease A [Penicillium roqueforti] 86 5e-15 gb|EKV05929.1| Vacuolar protease A [Penicillium digitatum PHI26]... 86 5e-15 ref|XP_002559391.1| Pc13g09680 [Penicillium chrysogenum Wisconsi... 86 5e-15 ref|XP_754479.1| aspartic endopeptidase Pep2 [Aspergillus fumiga... 86 5e-15 ref|XP_007582583.1| putative aspartic endopeptidase pep2 protein... 86 7e-15 ref|XP_003845423.1| similar to Vacuolar aspartyl protease (prote... 86 7e-15 dbj|GAD99029.1| aspartic endopeptidase Pep2 [Byssochlamys specta... 85 1e-14 ref|XP_001793880.1| hypothetical protein SNOG_03312 [Phaeosphaer... 85 1e-14 gb|EOA84985.1| hypothetical protein SETTUDRAFT_163750 [Setosphae... 84 2e-14 ref|XP_001941895.1| vacuolar protease A precursor [Pyrenophora t... 84 2e-14 ref|XP_001263323.1| aspartic endopeptidase Pep2 [Neosartorya fis... 84 2e-14 >gb|AAA20876.1| pepsinogen [Aspergillus niger] gi|350634685|gb|EHA23047.1| extracellular aspartic protease [Aspergillus niger ATCC 1015] Length = 398 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 1 AFMGMDFPEPVGPLAILGDAFLRRWYSIYDLGNDAVGLAKAK 126 AFMGMDFPEPVGPLAILGDAFLR+WYS+YDLGN AVGLAKAK Sbjct: 357 AFMGMDFPEPVGPLAILGDAFLRKWYSVYDLGNSAVGLAKAK 398 >gb|EKG17726.1| Peptidase A1 [Macrophomina phaseolina MS6] Length = 378 Score = 86.7 bits (213), Expect = 3e-15 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +1 Query: 1 AFMGMDFPEPVGPLAILGDAFLRRWYSIYDLGNDAVGLAKAK 126 AFMGMDFPEP GPLAILGDAFLR+WYS+YDLGNDAVG+AKAK Sbjct: 337 AFMGMDFPEPAGPLAILGDAFLRKWYSVYDLGNDAVGIAKAK 378 >dbj|GAA88863.1| aspartic protease (PepE) [Aspergillus kawachii IFO 4308] Length = 398 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 1 AFMGMDFPEPVGPLAILGDAFLRRWYSIYDLGNDAVGLAKAK 126 AFMGMDFPEPVGPLAILGDAFLR+WYS+YDLGN AVGLAKAK Sbjct: 357 AFMGMDFPEPVGPLAILGDAFLRKWYSVYDLGNSAVGLAKAK 398 >ref|XP_002143541.1| aspartic endopeptidase Pep2 [Talaromyces marneffei ATCC 18224] gi|210072939|gb|EEA27026.1| aspartic endopeptidase Pep2 [Talaromyces marneffei ATCC 18224] Length = 395 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +1 Query: 1 AFMGMDFPEPVGPLAILGDAFLRRWYSIYDLGNDAVGLAKAK 126 AFMGMDFPEPVGPLAILGDAFLR+WYSIYDLGN AVGLAKAK Sbjct: 354 AFMGMDFPEPVGPLAILGDAFLRKWYSIYDLGNGAVGLAKAK 395 >ref|XP_001399855.1| vacuolar protease A [Aspergillus niger CBS 513.88] gi|134056777|emb|CAK37685.1| aspartic protease pepE-Aspergillus niger Length = 398 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 1 AFMGMDFPEPVGPLAILGDAFLRRWYSIYDLGNDAVGLAKAK 126 AFMGMDFPEPVGPLAILGDAFLR+WYS+YDLGN AVGLAKAK Sbjct: 357 AFMGMDFPEPVGPLAILGDAFLRKWYSVYDLGNSAVGLAKAK 398 >ref|XP_001819842.1| vacuolar protease A [Aspergillus oryzae RIB40] gi|238486794|ref|XP_002374635.1| aspartic endopeptidase Pep2 [Aspergillus flavus NRRL3357] gi|21392388|dbj|BAC00850.1| pepsinogen [Aspergillus oryzae] gi|83767701|dbj|BAE57840.1| unnamed protein product [Aspergillus oryzae RIB40] gi|220699514|gb|EED55853.1| aspartic endopeptidase Pep2 [Aspergillus flavus NRRL3357] gi|391867458|gb|EIT76704.1| aspartyl protease [Aspergillus oryzae 3.042] Length = 397 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 1 AFMGMDFPEPVGPLAILGDAFLRRWYSIYDLGNDAVGLAKAK 126 AFMGMDFPEPVGPLAILGDAFLR+WYS+YDLGN AVGLAKAK Sbjct: 356 AFMGMDFPEPVGPLAILGDAFLRKWYSVYDLGNGAVGLAKAK 397 >ref|XP_002479865.1| aspartic endopeptidase Pep2 [Talaromyces stipitatus ATCC 10500] gi|218720012|gb|EED19431.1| aspartic endopeptidase Pep2 [Talaromyces stipitatus ATCC 10500] Length = 395 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 1 AFMGMDFPEPVGPLAILGDAFLRRWYSIYDLGNDAVGLAKAK 126 AFMGMDFPEPVGPLAILGDAFLR+WYS+YDLGN AVGLAKAK Sbjct: 354 AFMGMDFPEPVGPLAILGDAFLRKWYSVYDLGNGAVGLAKAK 395 >ref|XP_001213854.1| vacuolar protease A precursor [Aspergillus terreus NIH2624] gi|114193423|gb|EAU35123.1| vacuolar protease A precursor [Aspergillus terreus NIH2624] Length = 397 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 1 AFMGMDFPEPVGPLAILGDAFLRRWYSIYDLGNDAVGLAKAK 126 AFMGMDFPEPVGPLAILGDAFLR+WYS+YDLGN AVGLAKAK Sbjct: 356 AFMGMDFPEPVGPLAILGDAFLRKWYSVYDLGNGAVGLAKAK 397 >ref|XP_660507.1| hypothetical protein AN2903.2 [Aspergillus nidulans FGSC A4] gi|40744298|gb|EAA63474.1| hypothetical protein AN2903.2 [Aspergillus nidulans FGSC A4] gi|259486160|tpe|CBF83780.1| TPA: vacuolar aspartyl protease (proteinase A) (Eurofung) [Aspergillus nidulans FGSC A4] Length = 394 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 1 AFMGMDFPEPVGPLAILGDAFLRRWYSIYDLGNDAVGLAKAK 126 AFMGMDFPEPVGPLAILGDAFLR+WYS+YDLGN AVGLAKAK Sbjct: 353 AFMGMDFPEPVGPLAILGDAFLRKWYSVYDLGNGAVGLAKAK 394 >emb|CDM30585.1| Vacuolar protease A [Penicillium roqueforti] Length = 399 Score = 85.9 bits (211), Expect = 5e-15 Identities = 38/42 (90%), Positives = 42/42 (100%) Frame = +1 Query: 1 AFMGMDFPEPVGPLAILGDAFLRRWYSIYDLGNDAVGLAKAK 126 +FMGMDFPEPVGPLAILGDAFLRRWYS+YD+GN+AVGLAKAK Sbjct: 358 SFMGMDFPEPVGPLAILGDAFLRRWYSVYDVGNNAVGLAKAK 399 >gb|EKV05929.1| Vacuolar protease A [Penicillium digitatum PHI26] gi|425779798|gb|EKV17829.1| Vacuolar protease A [Penicillium digitatum Pd1] Length = 399 Score = 85.9 bits (211), Expect = 5e-15 Identities = 38/42 (90%), Positives = 42/42 (100%) Frame = +1 Query: 1 AFMGMDFPEPVGPLAILGDAFLRRWYSIYDLGNDAVGLAKAK 126 +FMGMDFPEPVGPLAILGDAFLRRWYS+YD+GN+AVGLAKAK Sbjct: 358 SFMGMDFPEPVGPLAILGDAFLRRWYSVYDVGNNAVGLAKAK 399 >ref|XP_002559391.1| Pc13g09680 [Penicillium chrysogenum Wisconsin 54-1255] gi|211584011|emb|CAP92037.1| Pc13g09680 [Penicillium chrysogenum Wisconsin 54-1255] Length = 398 Score = 85.9 bits (211), Expect = 5e-15 Identities = 38/42 (90%), Positives = 42/42 (100%) Frame = +1 Query: 1 AFMGMDFPEPVGPLAILGDAFLRRWYSIYDLGNDAVGLAKAK 126 +FMGMDFPEPVGPLAILGDAFLRRWYS+YD+GN+AVGLAKAK Sbjct: 357 SFMGMDFPEPVGPLAILGDAFLRRWYSVYDVGNNAVGLAKAK 398 >ref|XP_754479.1| aspartic endopeptidase Pep2 [Aspergillus fumigatus Af293] gi|74675969|sp|O42630.1|CARP_ASPFU RecName: Full=Vacuolar protease A; AltName: Full=Aspartic endopeptidase pep2; AltName: Full=Aspartic protease pep2; Flags: Precursor gi|2664292|emb|CAA75754.1| cellular aspartic protease [Aspergillus fumigatus] gi|4200293|emb|CAA10674.1| aspartic protease [Aspergillus fumigatus] gi|66852116|gb|EAL92441.1| aspartic endopeptidase Pep2 [Aspergillus fumigatus Af293] gi|159127496|gb|EDP52611.1| aspartic endopeptidase Pep2 [Aspergillus fumigatus A1163] Length = 398 Score = 85.9 bits (211), Expect = 5e-15 Identities = 38/42 (90%), Positives = 42/42 (100%) Frame = +1 Query: 1 AFMGMDFPEPVGPLAILGDAFLRRWYSIYDLGNDAVGLAKAK 126 +FMGMDFPEPVGPLAILGDAFLR+WYS+YDLGN+AVGLAKAK Sbjct: 357 SFMGMDFPEPVGPLAILGDAFLRKWYSVYDLGNNAVGLAKAK 398 >ref|XP_007582583.1| putative aspartic endopeptidase pep2 protein [Neofusicoccum parvum UCRNP2] gi|485925261|gb|EOD49884.1| putative aspartic endopeptidase pep2 protein [Neofusicoccum parvum UCRNP2] Length = 400 Score = 85.5 bits (210), Expect = 7e-15 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +1 Query: 1 AFMGMDFPEPVGPLAILGDAFLRRWYSIYDLGNDAVGLAKAK 126 AFMGMDFPEP GPLAILGDAFLR+WYS+YDLGN+AVGLAKAK Sbjct: 359 AFMGMDFPEPAGPLAILGDAFLRKWYSVYDLGNNAVGLAKAK 400 >ref|XP_003845423.1| similar to Vacuolar aspartyl protease (proteinase A) [Leptosphaeria maculans JN3] gi|21914374|gb|AAM81358.1|AF522873_1 aspartyl proteinase [Leptosphaeria maculans] gi|312222004|emb|CBY01944.1| similar to Vacuolar aspartyl protease (proteinase A) [Leptosphaeria maculans JN3] Length = 397 Score = 85.5 bits (210), Expect = 7e-15 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +1 Query: 1 AFMGMDFPEPVGPLAILGDAFLRRWYSIYDLGNDAVGLAKAK 126 AFMGMDFPEPVGPLAILGDAFLR+WYS+YDLGN AVGLAK+K Sbjct: 356 AFMGMDFPEPVGPLAILGDAFLRKWYSVYDLGNSAVGLAKSK 397 >dbj|GAD99029.1| aspartic endopeptidase Pep2 [Byssochlamys spectabilis No. 5] Length = 398 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +1 Query: 1 AFMGMDFPEPVGPLAILGDAFLRRWYSIYDLGNDAVGLAKAK 126 + MGMDFPEPVGPLAILGDAFLRRWYS+YDLGN+AVGLAKAK Sbjct: 357 SLMGMDFPEPVGPLAILGDAFLRRWYSVYDLGNNAVGLAKAK 398 >ref|XP_001793880.1| hypothetical protein SNOG_03312 [Phaeosphaeria nodorum SN15] gi|111068923|gb|EAT90043.1| hypothetical protein SNOG_03312 [Phaeosphaeria nodorum SN15] Length = 347 Score = 84.7 bits (208), Expect = 1e-14 Identities = 37/42 (88%), Positives = 42/42 (100%) Frame = +1 Query: 1 AFMGMDFPEPVGPLAILGDAFLRRWYSIYDLGNDAVGLAKAK 126 AFMGMDFPEPVGPLAILGDAFLR+WYS+YD+GN+AVGLAK+K Sbjct: 306 AFMGMDFPEPVGPLAILGDAFLRKWYSVYDVGNNAVGLAKSK 347 >gb|EOA84985.1| hypothetical protein SETTUDRAFT_163750 [Setosphaeria turcica Et28A] Length = 399 Score = 84.3 bits (207), Expect = 2e-14 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +1 Query: 1 AFMGMDFPEPVGPLAILGDAFLRRWYSIYDLGNDAVGLAKAK 126 AFMGMDFPEP GPLAILGDAFLR+WYS+YD+GN AVGLAKAK Sbjct: 358 AFMGMDFPEPTGPLAILGDAFLRKWYSVYDMGNSAVGLAKAK 399 >ref|XP_001941895.1| vacuolar protease A precursor [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187977988|gb|EDU44614.1| vacuolar protease A precursor [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 399 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 1 AFMGMDFPEPVGPLAILGDAFLRRWYSIYDLGNDAVGLAKAK 126 A MGMDFPEPVGPLAILGDAFLR+WYS+YDLGN AVGLAKAK Sbjct: 358 ALMGMDFPEPVGPLAILGDAFLRKWYSVYDLGNSAVGLAKAK 399 >ref|XP_001263323.1| aspartic endopeptidase Pep2 [Neosartorya fischeri NRRL 181] gi|119411483|gb|EAW21426.1| aspartic endopeptidase Pep2 [Neosartorya fischeri NRRL 181] Length = 398 Score = 84.3 bits (207), Expect = 2e-14 Identities = 37/42 (88%), Positives = 42/42 (100%) Frame = +1 Query: 1 AFMGMDFPEPVGPLAILGDAFLRRWYSIYDLGNDAVGLAKAK 126 +FMGMDFPEPVGPLAILGDAFLR+WYS+YDLGN+AVGLA+AK Sbjct: 357 SFMGMDFPEPVGPLAILGDAFLRKWYSVYDLGNNAVGLAEAK 398