BLASTX nr result
ID: Akebia27_contig00041125
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00041125 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74535.1| hypothetical protein M569_00252, partial [Genlise... 65 1e-08 >gb|EPS74535.1| hypothetical protein M569_00252, partial [Genlisea aurea] Length = 106 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/54 (59%), Positives = 37/54 (68%), Gaps = 4/54 (7%) Frame = -2 Query: 317 VGPCNRIDTQCPFNL*VQCD----KGRKIHRATPSSPPCRNYEITPRMPLASRG 168 VGPC ++D PFN ++ KGRKIH TPSSPP RNYEITPR P A+RG Sbjct: 28 VGPCEQLDALSPFNPLIEMRQNKRKGRKIHGPTPSSPPRRNYEITPRAPSAARG 81