BLASTX nr result
ID: Akebia27_contig00041098
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00041098 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC91146.1| hypothetical protein BAUCODRAFT_316419 [Baudoinia... 65 1e-08 gb|EON69159.1| hypothetical protein W97_08517 [Coniosporium apol... 55 8e-06 >gb|EMC91146.1| hypothetical protein BAUCODRAFT_316419 [Baudoinia compniacensis UAMH 10762] Length = 88 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -2 Query: 132 NSNVFETPGVKNIGERYASNGGTETHMPGVATPRGSAEKQAPNQ 1 +SNVFETPGVKNIG+RYA+ G + TH GVATPRG+++ NQ Sbjct: 2 HSNVFETPGVKNIGDRYAAGGASNTHQTGVATPRGNSDNTISNQ 45 >gb|EON69159.1| hypothetical protein W97_08517 [Coniosporium apollinis CBS 100218] Length = 98 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/42 (57%), Positives = 30/42 (71%) Frame = -2 Query: 126 NVFETPGVKNIGERYASNGGTETHMPGVATPRGSAEKQAPNQ 1 NVFETPG K IG+R+++ GG +TH PG AT RG + PNQ Sbjct: 8 NVFETPGSKQIGDRWSAAGGKDTHTPGAATRRGDPDHVEPNQ 49