BLASTX nr result
ID: Akebia27_contig00040837
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00040837 (397 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME47101.1| hypothetical protein DOTSEDRAFT_69164 [Dothistrom... 57 3e-06 >gb|EME47101.1| hypothetical protein DOTSEDRAFT_69164 [Dothistroma septosporum NZE10] Length = 487 Score = 56.6 bits (135), Expect = 3e-06 Identities = 37/68 (54%), Positives = 43/68 (63%), Gaps = 13/68 (19%) Frame = -3 Query: 167 KRNVKFNSSRERHMSRGSMES----SPVDER---RSNGAKSPTRNGDL------KRPQVD 27 K++VKFN RER +S+ SM SP DER R NGAKSPTRNG L +RP +D Sbjct: 5 KKDVKFNH-RERRLSKSSMSDFNYESPNDERSPSRHNGAKSPTRNGALSKQIGNERPAID 63 Query: 26 RNDTGASG 3 R DT ASG Sbjct: 64 RTDTTASG 71