BLASTX nr result
ID: Akebia27_contig00040328
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00040328 (540 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003853378.1| hypothetical protein MYCGRDRAFT_109154 [Zymo... 57 4e-06 >ref|XP_003853378.1| hypothetical protein MYCGRDRAFT_109154 [Zymoseptoria tritici IPO323] gi|339473260|gb|EGP88354.1| hypothetical protein MYCGRDRAFT_109154 [Zymoseptoria tritici IPO323] Length = 1237 Score = 56.6 bits (135), Expect = 4e-06 Identities = 40/112 (35%), Positives = 52/112 (46%), Gaps = 13/112 (11%) Frame = -2 Query: 521 RRRGATSRRVDVQP--PPR-----SLRPDLERKNSHEHQRFRSMRDDYESDEGE------ 381 RR G+ SR D+ P P S PDLERKN + +RFR MRD YES+EGE Sbjct: 59 RREGSRSRVPDLAPQFPDEASYLGSNAPDLERKNRPKDRRFREMRDGYESEEGEEHRKRG 118 Query: 380 TLKKSKKRPTSSGEDGLPKPPTHQPSRSKHAEPSAPLETEMPVRTRGPPPTD 225 +K ++RPT PP + + E E + P PP+D Sbjct: 119 PKEKMERRPTDDDYSSRGPPPRRRDRDPRDRERDRERERDDPRDNPPYPPSD 170