BLASTX nr result
ID: Akebia27_contig00040083
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00040083 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS84589.1| hypothetical protein PFICI_02614 [Pestalotiopsis ... 118 1e-24 >gb|ETS84589.1| hypothetical protein PFICI_02614 [Pestalotiopsis fici W106-1] Length = 324 Score = 118 bits (295), Expect = 1e-24 Identities = 54/59 (91%), Positives = 56/59 (94%) Frame = -2 Query: 378 CKLAWGPEKGWDDGEEYIAPEPIPNNDPIGIAAIVDGRVIPANTGLLNPNYDPNIITFT 202 CKLAWGPEKGWDDGEE I PEPIPNN+PIGIAAIVDGR+IPANTG LNPNYDPNIITFT Sbjct: 266 CKLAWGPEKGWDDGEEIIPPEPIPNNEPIGIAAIVDGRMIPANTG-LNPNYDPNIITFT 323