BLASTX nr result
ID: Akebia27_contig00039665
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00039665 (360 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006856230.1| hypothetical protein AMTR_s00059p00209410 [A... 41 6e-06 >ref|XP_006856230.1| hypothetical protein AMTR_s00059p00209410 [Amborella trichopoda] gi|548860089|gb|ERN17697.1| hypothetical protein AMTR_s00059p00209410 [Amborella trichopoda] Length = 936 Score = 40.8 bits (94), Expect(2) = 6e-06 Identities = 16/30 (53%), Positives = 24/30 (80%) Frame = +2 Query: 161 HRTLNLDKTSLCKSILNGRHDSKSALLLLQ 250 H T++LD TSLC+ I NGRHDSK+ ++ ++ Sbjct: 862 HGTVDLDNTSLCRPISNGRHDSKNVIIRVE 891 Score = 34.7 bits (78), Expect(2) = 6e-06 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = +3 Query: 3 KIKYEKNLVATINMKGGKGGL--SVIIWKLTEIVI*SHGPGFISHSRIVE 146 KIKYE+ N+ G GGL I+ KL + S G G++SH +I+E Sbjct: 807 KIKYERGAAVAFNLNKGNGGLINPEIVQKLADKDGISLGIGYLSHIKIME 856