BLASTX nr result
ID: Akebia27_contig00039337
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00039337 (854 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS87485.1| hypothetical protein PFICI_01313 [Pestalotiopsis ... 62 4e-07 >gb|ETS87485.1| hypothetical protein PFICI_01313 [Pestalotiopsis fici W106-1] Length = 563 Score = 61.6 bits (148), Expect = 4e-07 Identities = 27/36 (75%), Positives = 29/36 (80%), Gaps = 2/36 (5%) Frame = -3 Query: 852 PRQFMPQP--AAPAVTQGWSNPQTSSSGNWWANQPQ 751 PRQFMPQ +PAVTQGWSN QT + GNWWANQPQ Sbjct: 528 PRQFMPQNPGGSPAVTQGWSNQQTPAGGNWWANQPQ 563