BLASTX nr result
ID: Akebia27_contig00039245
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00039245 (342 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EHY57613.1| serine/threonine kinase 16 [Exophiala dermatitidi... 57 3e-06 gb|EXJ95080.1| hypothetical protein A1O1_00198 [Capronia coronat... 56 6e-06 >gb|EHY57613.1| serine/threonine kinase 16 [Exophiala dermatitidis NIH/UT8656] Length = 563 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = -2 Query: 95 MEMNYDERELHQLETELNVEIVPGTEIMADV 3 MEMNYDE+ELHQ+E EL+VE++PGTE+MADV Sbjct: 1 MEMNYDEKELHQIEEELHVELLPGTELMADV 31 >gb|EXJ95080.1| hypothetical protein A1O1_00198 [Capronia coronata CBS 617.96] Length = 560 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = -2 Query: 95 MEMNYDERELHQLETELNVEIVPGTEIMADV 3 MEMNYDE+ELH++E EL+VE++PGTEIMADV Sbjct: 1 MEMNYDEKELHRIEEELHVELLPGTEIMADV 31