BLASTX nr result
ID: Akebia27_contig00038639
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00038639 (464 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON69513.1| chitin synthase G [Coniosporium apollinis CBS 100... 64 2e-08 ref|XP_001796923.1| hypothetical protein SNOG_06555 [Phaeosphaer... 61 2e-07 >gb|EON69513.1| chitin synthase G [Coniosporium apollinis CBS 100218] Length = 901 Score = 64.3 bits (155), Expect = 2e-08 Identities = 40/96 (41%), Positives = 50/96 (52%), Gaps = 15/96 (15%) Frame = -1 Query: 296 HDGYDDEAERSLLHANAMGAHPSGYDDPIG------NRPSSAYTLTESYADGADSRTAGY 135 HD D+E ERSLLH N GA P +DD +RP S Y+L+E+YA GA + Y Sbjct: 33 HDSEDEEVERSLLHPNPTGARPGPFDDHDDHSHMGRSRPDSTYSLSETYAQGA-TPAPSY 91 Query: 134 QHAGYDDSQEKY---------YGASQDDPSGAFGVP 54 + GY D E Y YG DDP+ A+G P Sbjct: 92 RTGGYADGPEVYSGPQETLQGYGGPVDDPA-AYGHP 126 >ref|XP_001796923.1| hypothetical protein SNOG_06555 [Phaeosphaeria nodorum SN15] gi|160707133|gb|EAT86386.2| hypothetical protein SNOG_06555 [Phaeosphaeria nodorum SN15] Length = 792 Score = 60.8 bits (146), Expect = 2e-07 Identities = 37/89 (41%), Positives = 43/89 (48%), Gaps = 5/89 (5%) Frame = -1 Query: 305 GGVHDGYD----DEAERSLLHANAMGAHPSG-YDDPIGNRPSSAYTLTESYADGADSRTA 141 G H GYD DE RSLLH N GAHP Y P RP S Y+L+E+YA ++ Sbjct: 9 GEPHTGYDRRDEDEVARSLLHENPTGAHPDPFYGHPAEQRPHSTYSLSETYATDRPTQYP 68 Query: 140 GYQHAGYDDSQEKYYGASQDDPSGAFGVP 54 G H G D Y DP+ FG P Sbjct: 69 GQAHEGSD----VYSATGGYDPASDFGAP 93