BLASTX nr result
ID: Akebia27_contig00038387
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00038387 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006858679.1| hypothetical protein AMTR_s00066p00082400 [A... 55 8e-06 >ref|XP_006858679.1| hypothetical protein AMTR_s00066p00082400 [Amborella trichopoda] gi|548862790|gb|ERN20146.1| hypothetical protein AMTR_s00066p00082400 [Amborella trichopoda] Length = 992 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/36 (63%), Positives = 32/36 (88%) Frame = +2 Query: 2 GKAPDETTKRLLVEACYKRREFELAFMLEESILVYK 109 GK P+E+TK L+EACY +REFE+AFM+EE++LVY+ Sbjct: 956 GKLPEESTKTQLIEACYMQREFEMAFMIEENMLVYE 991