BLASTX nr result
ID: Akebia27_contig00037434
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00037434 (335 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001791136.1| hypothetical protein SNOG_00451 [Phaeosphaer... 194 8e-48 gb|EMD64036.1| hypothetical protein COCSADRAFT_36616 [Bipolaris ... 194 1e-47 gb|EME83473.1| hypothetical protein MYCFIDRAFT_70900 [Pseudocerc... 193 2e-47 gb|ELR04864.1| 50S ribosomal protein L34e [Pseudogymnoascus dest... 193 2e-47 ref|XP_007583931.1| putative 60s ribosomal protein l34 protein [... 193 2e-47 gb|EMD88396.1| hypothetical protein COCHEDRAFT_1141965, partial ... 192 3e-47 ref|XP_001554613.1| 60S ribosomal protein L34 [Botryotinia fucke... 189 3e-46 ref|XP_001940651.1| 60S ribosomal protein L34 [Pyrenophora triti... 189 5e-46 gb|ESZ98403.1| 60S ribosomal protein L34 [Sclerotinia borealis F... 188 8e-46 gb|EOA86509.1| hypothetical protein SETTUDRAFT_162779 [Setosphae... 187 1e-45 gb|EMC99893.1| hypothetical protein BAUCODRAFT_63840 [Baudoinia ... 187 1e-45 ref|XP_003855902.1| 60S ribosomal protein L34 [Zymoseptoria trit... 187 1e-45 gb|EPS30302.1| hypothetical protein PDE_05253 [Penicillium oxali... 187 2e-45 dbj|GAD93357.1| 60S ribosomal protein L34 [Byssochlamys spectabi... 186 3e-45 ref|XP_007289829.1| 60S ribosomal protein L34 [Marssonina brunne... 186 3e-45 ref|XP_001265868.1| 60S ribosomal protein L34 [Neosartorya fisch... 185 6e-45 gb|EKV07821.1| Ribosomal protein L34 protein, putative [Penicill... 184 1e-44 ref|XP_002562247.1| Pc18g04110 [Penicillium chrysogenum Wisconsi... 183 2e-44 emb|CDM33603.1| 60S ribosomal protein L34-A [Penicillium roquefo... 183 2e-44 gb|EMF14803.1| ribosomal protein L34 protein [Sphaerulina musiva... 182 4e-44 >ref|XP_001791136.1| hypothetical protein SNOG_00451 [Phaeosphaeria nodorum SN15] gi|111070826|gb|EAT91946.1| hypothetical protein SNOG_00451 [Phaeosphaeria nodorum SN15] Length = 114 Score = 194 bits (494), Expect = 8e-48 Identities = 89/100 (89%), Positives = 96/100 (96%) Frame = +1 Query: 34 MPSNRLTYRRRQPYNTKSNKVRIVRTPGGELRYLHTKKKGTAPKCGDCGTKLPGIPALRP 213 MPSNRLTYRRR PYNTKS KVR+++TPGGELRYLH KKKGTAPKCGDCGTKL GIPALRP Sbjct: 1 MPSNRLTYRRRAPYNTKSQKVRVIKTPGGELRYLHIKKKGTAPKCGDCGTKLAGIPALRP 60 Query: 214 REYATITRPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK 333 REYAT++RPKKTVQRAYGGSRCANCV+DR+VRAFLIEEQK Sbjct: 61 REYATVSRPKKTVQRAYGGSRCANCVQDRIVRAFLIEEQK 100 >gb|EMD64036.1| hypothetical protein COCSADRAFT_36616 [Bipolaris sorokiniana ND90Pr] gi|576918189|gb|EUC32391.1| hypothetical protein COCCADRAFT_37637 [Bipolaris zeicola 26-R-13] gi|576931827|gb|EUC45380.1| hypothetical protein COCMIDRAFT_26405 [Bipolaris oryzae ATCC 44560] gi|578490392|gb|EUN27808.1| hypothetical protein COCVIDRAFT_97298 [Bipolaris victoriae FI3] Length = 114 Score = 194 bits (492), Expect = 1e-47 Identities = 90/100 (90%), Positives = 95/100 (95%) Frame = +1 Query: 34 MPSNRLTYRRRQPYNTKSNKVRIVRTPGGELRYLHTKKKGTAPKCGDCGTKLPGIPALRP 213 MPSNRLTYRRR PYNTKS KVRIVRTPGGELRYLH KKKGTAPKCGDCGTKL G+PALRP Sbjct: 1 MPSNRLTYRRRAPYNTKSQKVRIVRTPGGELRYLHIKKKGTAPKCGDCGTKLQGVPALRP 60 Query: 214 REYATITRPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK 333 REYA ++RPKKTVQRAYGGSRCANCV+DR+VRAFLIEEQK Sbjct: 61 REYAQVSRPKKTVQRAYGGSRCANCVQDRIVRAFLIEEQK 100 >gb|EME83473.1| hypothetical protein MYCFIDRAFT_70900 [Pseudocercospora fijiensis CIRAD86] Length = 117 Score = 193 bits (491), Expect = 2e-47 Identities = 87/100 (87%), Positives = 96/100 (96%) Frame = +1 Query: 34 MPSNRLTYRRRQPYNTKSNKVRIVRTPGGELRYLHTKKKGTAPKCGDCGTKLPGIPALRP 213 MPSNRLTYRRRQ YNTKSN+VR+++TPGGELRYLH KK+GTAPKCGDCGTKLPG+PALRP Sbjct: 1 MPSNRLTYRRRQSYNTKSNRVRVIKTPGGELRYLHIKKRGTAPKCGDCGTKLPGVPALRP 60 Query: 214 REYATITRPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK 333 REYAT++ PKKTV R+YGGSRCANCVKDRVVRAFLIEEQK Sbjct: 61 REYATVSHPKKTVSRSYGGSRCANCVKDRVVRAFLIEEQK 100 >gb|ELR04864.1| 50S ribosomal protein L34e [Pseudogymnoascus destructans 20631-21] Length = 113 Score = 193 bits (491), Expect = 2e-47 Identities = 88/100 (88%), Positives = 95/100 (95%) Frame = +1 Query: 34 MPSNRLTYRRRQPYNTKSNKVRIVRTPGGELRYLHTKKKGTAPKCGDCGTKLPGIPALRP 213 MPSNRLTYRRR PYNT SNKVR++RTPGG+LRYLH KKKGTAPKCGDCG KLPG+PALRP Sbjct: 1 MPSNRLTYRRRNPYNTTSNKVRVIRTPGGKLRYLHLKKKGTAPKCGDCGIKLPGVPALRP 60 Query: 214 REYATITRPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK 333 REYA I+RPKKTVQRAYGGSRCANCV+DR+VRAFLIEEQK Sbjct: 61 REYAQISRPKKTVQRAYGGSRCANCVRDRIVRAFLIEEQK 100 >ref|XP_007583931.1| putative 60s ribosomal protein l34 protein [Neofusicoccum parvum UCRNP2] gi|407919736|gb|EKG12961.1| Ribosomal protein L34Ae [Macrophomina phaseolina MS6] gi|485923429|gb|EOD48599.1| putative 60s ribosomal protein l34 protein [Neofusicoccum parvum UCRNP2] Length = 114 Score = 193 bits (490), Expect = 2e-47 Identities = 88/100 (88%), Positives = 96/100 (96%) Frame = +1 Query: 34 MPSNRLTYRRRQPYNTKSNKVRIVRTPGGELRYLHTKKKGTAPKCGDCGTKLPGIPALRP 213 MPSNRLTYRRR PYNT+SNKVR+++TPGG+LRYLH KKKGTAPKCGDCG+KL G+PALRP Sbjct: 1 MPSNRLTYRRRTPYNTRSNKVRVIKTPGGQLRYLHIKKKGTAPKCGDCGSKLAGVPALRP 60 Query: 214 REYATITRPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK 333 EYATI+RPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK Sbjct: 61 HEYATISRPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK 100 >gb|EMD88396.1| hypothetical protein COCHEDRAFT_1141965, partial [Bipolaris maydis C5] gi|477583667|gb|ENI00764.1| hypothetical protein COCC4DRAFT_149701 [Bipolaris maydis ATCC 48331] Length = 114 Score = 192 bits (489), Expect = 3e-47 Identities = 89/100 (89%), Positives = 95/100 (95%) Frame = +1 Query: 34 MPSNRLTYRRRQPYNTKSNKVRIVRTPGGELRYLHTKKKGTAPKCGDCGTKLPGIPALRP 213 MPSNRLTYRRR PYNT+S KVRIVRTPGGELRYLH KKKGTAPKCGDCGTKL G+PALRP Sbjct: 1 MPSNRLTYRRRAPYNTRSQKVRIVRTPGGELRYLHIKKKGTAPKCGDCGTKLQGVPALRP 60 Query: 214 REYATITRPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK 333 REYA ++RPKKTVQRAYGGSRCANCV+DR+VRAFLIEEQK Sbjct: 61 REYAQVSRPKKTVQRAYGGSRCANCVQDRIVRAFLIEEQK 100 >ref|XP_001554613.1| 60S ribosomal protein L34 [Botryotinia fuckeliana B05.10] gi|156058396|ref|XP_001595121.1| 60S ribosomal protein L34 [Sclerotinia sclerotiorum 1980 UF-70] gi|154700997|gb|EDO00736.1| 60S ribosomal protein L34 [Sclerotinia sclerotiorum 1980 UF-70] gi|347839489|emb|CCD54061.1| similar to 60s ribosomal protein L34 [Botryotinia fuckeliana T4] gi|472235749|gb|EMR80709.1| putative 60s ribosomal protein l34 protein [Botryotinia fuckeliana BcDW1] Length = 114 Score = 189 bits (480), Expect = 3e-46 Identities = 87/100 (87%), Positives = 94/100 (94%) Frame = +1 Query: 34 MPSNRLTYRRRQPYNTKSNKVRIVRTPGGELRYLHTKKKGTAPKCGDCGTKLPGIPALRP 213 M SNRLTYRRR PYNT+SNKVR+V+TPGGELRYLH KK GTAPKCGDCG KLPGIPALRP Sbjct: 1 MSSNRLTYRRRNPYNTRSNKVRVVKTPGGELRYLHIKKAGTAPKCGDCGIKLPGIPALRP 60 Query: 214 REYATITRPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK 333 REY+ I+RPKKTVQRAYGGSRCANCV+DR+VRAFLIEEQK Sbjct: 61 REYSQISRPKKTVQRAYGGSRCANCVRDRIVRAFLIEEQK 100 >ref|XP_001940651.1| 60S ribosomal protein L34 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330928003|ref|XP_003302089.1| 60S ribosomal protein L34 [Pyrenophora teres f. teres 0-1] gi|187976744|gb|EDU43370.1| 60S ribosomal protein L34-B [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311322747|gb|EFQ89813.1| hypothetical protein PTT_13782 [Pyrenophora teres f. teres 0-1] Length = 114 Score = 189 bits (479), Expect = 5e-46 Identities = 86/100 (86%), Positives = 94/100 (94%) Frame = +1 Query: 34 MPSNRLTYRRRQPYNTKSNKVRIVRTPGGELRYLHTKKKGTAPKCGDCGTKLPGIPALRP 213 MPSNRLTYRRR PYNTKS KVR+++TPGGELRYLH KK+GTAPKCGDCGTKL G+PALRP Sbjct: 1 MPSNRLTYRRRAPYNTKSQKVRVIKTPGGELRYLHIKKRGTAPKCGDCGTKLQGVPALRP 60 Query: 214 REYATITRPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK 333 REYA I+RPKKTVQRAYGGSRCA CV+DR+VRAFLIEEQK Sbjct: 61 REYAQISRPKKTVQRAYGGSRCAGCVQDRIVRAFLIEEQK 100 >gb|ESZ98403.1| 60S ribosomal protein L34 [Sclerotinia borealis F-4157] Length = 114 Score = 188 bits (477), Expect = 8e-46 Identities = 87/100 (87%), Positives = 93/100 (93%) Frame = +1 Query: 34 MPSNRLTYRRRQPYNTKSNKVRIVRTPGGELRYLHTKKKGTAPKCGDCGTKLPGIPALRP 213 M S RLTYRRR PYNTKSNKVR+V+TPGGELRYLH KK GTAPKCGDCG KLPGIPALRP Sbjct: 1 MSSTRLTYRRRNPYNTKSNKVRVVKTPGGELRYLHIKKAGTAPKCGDCGIKLPGIPALRP 60 Query: 214 REYATITRPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK 333 REY+ I+RPKKTVQRAYGGSRCANCV+DR+VRAFLIEEQK Sbjct: 61 REYSQISRPKKTVQRAYGGSRCANCVRDRIVRAFLIEEQK 100 >gb|EOA86509.1| hypothetical protein SETTUDRAFT_162779 [Setosphaeria turcica Et28A] Length = 114 Score = 187 bits (476), Expect = 1e-45 Identities = 85/100 (85%), Positives = 94/100 (94%) Frame = +1 Query: 34 MPSNRLTYRRRQPYNTKSNKVRIVRTPGGELRYLHTKKKGTAPKCGDCGTKLPGIPALRP 213 MPSNRLTYRRR PYNT+S KVRI++TPGGELRYLH KK+GTAPKCGDCGTKL G+PALRP Sbjct: 1 MPSNRLTYRRRAPYNTRSQKVRIIKTPGGELRYLHIKKRGTAPKCGDCGTKLQGVPALRP 60 Query: 214 REYATITRPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK 333 REYA ++RPKKTVQRAYGGSRCA CV+DR+VRAFLIEEQK Sbjct: 61 REYAQVSRPKKTVQRAYGGSRCAGCVQDRIVRAFLIEEQK 100 >gb|EMC99893.1| hypothetical protein BAUCODRAFT_63840 [Baudoinia compniacensis UAMH 10762] Length = 115 Score = 187 bits (476), Expect = 1e-45 Identities = 88/100 (88%), Positives = 93/100 (93%) Frame = +1 Query: 34 MPSNRLTYRRRQPYNTKSNKVRIVRTPGGELRYLHTKKKGTAPKCGDCGTKLPGIPALRP 213 MPS RL YRRRQPYNT SNKVRI+RTPGGE RYL+TKKKGTAPKCGDCGTKL GIPALRP Sbjct: 1 MPSTRLKYRRRQPYNTVSNKVRIIRTPGGEHRYLNTKKKGTAPKCGDCGTKLAGIPALRP 60 Query: 214 REYATITRPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK 333 REYATI+RPKKTV R+YGGSRCANC KDR+VRAFLIEEQK Sbjct: 61 REYATISRPKKTVSRSYGGSRCANCTKDRIVRAFLIEEQK 100 >ref|XP_003855902.1| 60S ribosomal protein L34 [Zymoseptoria tritici IPO323] gi|339475787|gb|EGP90878.1| hypothetical protein MYCGRDRAFT_102027 [Zymoseptoria tritici IPO323] Length = 116 Score = 187 bits (476), Expect = 1e-45 Identities = 87/96 (90%), Positives = 93/96 (96%) Frame = +1 Query: 46 RLTYRRRQPYNTKSNKVRIVRTPGGELRYLHTKKKGTAPKCGDCGTKLPGIPALRPREYA 225 RLTYRRR PYNTKSNKVR+V+TPGGELRYLH KK+GTAPKCGDCG+KL GIPALRPREYA Sbjct: 6 RLTYRRRMPYNTKSNKVRVVKTPGGELRYLHLKKRGTAPKCGDCGSKLAGIPALRPREYA 65 Query: 226 TITRPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK 333 TI+RPKKTVQRAYGGSRCANCV+DRVVRAFLIEEQK Sbjct: 66 TISRPKKTVQRAYGGSRCANCVRDRVVRAFLIEEQK 101 >gb|EPS30302.1| hypothetical protein PDE_05253 [Penicillium oxalicum 114-2] Length = 117 Score = 187 bits (474), Expect = 2e-45 Identities = 85/100 (85%), Positives = 92/100 (92%) Frame = +1 Query: 34 MPSNRLTYRRRQPYNTKSNKVRIVRTPGGELRYLHTKKKGTAPKCGDCGTKLPGIPALRP 213 MP+NRL YRRR PYNT+SNKVRI++TPGGELRYLH KKKGTAPKCGDCG KLPG+PALRP Sbjct: 1 MPNNRLQYRRRNPYNTRSNKVRIIKTPGGELRYLHLKKKGTAPKCGDCGIKLPGVPALRP 60 Query: 214 REYATITRPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK 333 REYA I+RPKK V RAYGGSRCA CVKDR+VRAFLIEEQK Sbjct: 61 REYAQISRPKKNVSRAYGGSRCAGCVKDRIVRAFLIEEQK 100 >dbj|GAD93357.1| 60S ribosomal protein L34 [Byssochlamys spectabilis No. 5] Length = 120 Score = 186 bits (472), Expect = 3e-45 Identities = 85/100 (85%), Positives = 92/100 (92%) Frame = +1 Query: 34 MPSNRLTYRRRQPYNTKSNKVRIVRTPGGELRYLHTKKKGTAPKCGDCGTKLPGIPALRP 213 M +NRL YRRR PYNT+SNKVR+V+TPGGELRYLH KKKGTAPKCGDCG KLPG+PALRP Sbjct: 1 MATNRLQYRRRNPYNTRSNKVRVVKTPGGELRYLHIKKKGTAPKCGDCGIKLPGVPALRP 60 Query: 214 REYATITRPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK 333 REYA I+RPKK V RAYGGSRCANCVKDR+VRAFLIEEQK Sbjct: 61 REYAQISRPKKNVSRAYGGSRCANCVKDRIVRAFLIEEQK 100 >ref|XP_007289829.1| 60S ribosomal protein L34 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406866949|gb|EKD19988.1| 60S ribosomal protein L34 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 114 Score = 186 bits (472), Expect = 3e-45 Identities = 86/100 (86%), Positives = 92/100 (92%) Frame = +1 Query: 34 MPSNRLTYRRRQPYNTKSNKVRIVRTPGGELRYLHTKKKGTAPKCGDCGTKLPGIPALRP 213 M SNRL YRRR PYNTKSNKVR+V+TPGG LRYLH KK GTAPKCGDCG KLPGIPALRP Sbjct: 1 MSSNRLIYRRRNPYNTKSNKVRVVKTPGGSLRYLHIKKAGTAPKCGDCGIKLPGIPALRP 60 Query: 214 REYATITRPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK 333 REY+ I+RPKKTVQRAYGGSRCANCV+DR+VRAFLIEEQK Sbjct: 61 REYSQISRPKKTVQRAYGGSRCANCVRDRIVRAFLIEEQK 100 >ref|XP_001265868.1| 60S ribosomal protein L34 [Neosartorya fischeri NRRL 181] gi|119414032|gb|EAW23971.1| ribosomal protein L34 protein, putative [Neosartorya fischeri NRRL 181] Length = 117 Score = 185 bits (469), Expect = 6e-45 Identities = 85/100 (85%), Positives = 92/100 (92%) Frame = +1 Query: 34 MPSNRLTYRRRQPYNTKSNKVRIVRTPGGELRYLHTKKKGTAPKCGDCGTKLPGIPALRP 213 M +NRL YRRR PYNT+SNKVRI++TPGGELRYLH KKKGTAPKCGDCG KLPGIPALRP Sbjct: 1 MANNRLQYRRRNPYNTRSNKVRIIKTPGGELRYLHIKKKGTAPKCGDCGIKLPGIPALRP 60 Query: 214 REYATITRPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK 333 REY+ I+RPKKTV RAYGGSRCA CVKDR+VRAFLIEEQK Sbjct: 61 REYSQISRPKKTVSRAYGGSRCAGCVKDRIVRAFLIEEQK 100 >gb|EKV07821.1| Ribosomal protein L34 protein, putative [Penicillium digitatum Pd1] gi|425770851|gb|EKV09311.1| Ribosomal protein L34 protein, putative [Penicillium digitatum PHI26] Length = 116 Score = 184 bits (466), Expect = 1e-44 Identities = 84/100 (84%), Positives = 92/100 (92%) Frame = +1 Query: 34 MPSNRLTYRRRQPYNTKSNKVRIVRTPGGELRYLHTKKKGTAPKCGDCGTKLPGIPALRP 213 M +NRL YRRR PYNT+SNKVRI++TPGGELRYLH KKKGTAPKCGDCG+KLPGIPALRP Sbjct: 1 MTNNRLQYRRRNPYNTRSNKVRIIKTPGGELRYLHLKKKGTAPKCGDCGSKLPGIPALRP 60 Query: 214 REYATITRPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK 333 REY+ I+RPKK V RAYGGSRCA CVKDR+VRAFLIEEQK Sbjct: 61 REYSQISRPKKNVSRAYGGSRCAGCVKDRIVRAFLIEEQK 100 >ref|XP_002562247.1| Pc18g04110 [Penicillium chrysogenum Wisconsin 54-1255] gi|211586980|emb|CAP94635.1| Pc18g04110 [Penicillium chrysogenum Wisconsin 54-1255] Length = 116 Score = 183 bits (465), Expect = 2e-44 Identities = 85/100 (85%), Positives = 91/100 (91%) Frame = +1 Query: 34 MPSNRLTYRRRQPYNTKSNKVRIVRTPGGELRYLHTKKKGTAPKCGDCGTKLPGIPALRP 213 M +NRL YRRR PYNT+SNKVRIV+TPGGELRYLH KKKGTAPKCGDCG KLPGIPALRP Sbjct: 1 MTNNRLQYRRRNPYNTRSNKVRIVKTPGGELRYLHLKKKGTAPKCGDCGIKLPGIPALRP 60 Query: 214 REYATITRPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK 333 REY+ I+RPKK V RAYGGSRCA CVKDR+VRAFLIEEQK Sbjct: 61 REYSQISRPKKNVSRAYGGSRCAGCVKDRIVRAFLIEEQK 100 >emb|CDM33603.1| 60S ribosomal protein L34-A [Penicillium roqueforti] Length = 116 Score = 183 bits (464), Expect = 2e-44 Identities = 84/100 (84%), Positives = 91/100 (91%) Frame = +1 Query: 34 MPSNRLTYRRRQPYNTKSNKVRIVRTPGGELRYLHTKKKGTAPKCGDCGTKLPGIPALRP 213 M +NRL YRRR PYNT+SNKVRI++TPGGELRYLH KKKGTAPKCGDCG KLPGIPALRP Sbjct: 1 MTNNRLQYRRRNPYNTRSNKVRIIKTPGGELRYLHLKKKGTAPKCGDCGIKLPGIPALRP 60 Query: 214 REYATITRPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK 333 REY+ I+RPKK V RAYGGSRCA CVKDR+VRAFLIEEQK Sbjct: 61 REYSQISRPKKNVSRAYGGSRCAGCVKDRIVRAFLIEEQK 100 >gb|EMF14803.1| ribosomal protein L34 protein [Sphaerulina musiva SO2202] Length = 117 Score = 182 bits (462), Expect = 4e-44 Identities = 86/100 (86%), Positives = 93/100 (93%) Frame = +1 Query: 34 MPSNRLTYRRRQPYNTKSNKVRIVRTPGGELRYLHTKKKGTAPKCGDCGTKLPGIPALRP 213 M S+RLT+RRR YNTKSNKVRI++TPGGELRYLH KKKGTAPKCGDCG+KL GIPALRP Sbjct: 1 MGSSRLTFRRRVSYNTKSNKVRIIKTPGGELRYLHIKKKGTAPKCGDCGSKLAGIPALRP 60 Query: 214 REYATITRPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK 333 REY+ I+ PKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK Sbjct: 61 REYSQISHPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQK 100