BLASTX nr result
ID: Akebia27_contig00037399
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00037399 (476 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633341.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 emb|CAN78867.1| hypothetical protein VITISV_041982 [Vitis vinifera] 75 1e-11 ref|XP_006856878.1| hypothetical protein AMTR_s00055p00197790 [A... 70 2e-10 ref|XP_007049305.1| Pentatricopeptide repeat-containing protein,... 69 5e-10 ref|XP_007049304.1| Pentatricopeptide repeat-containing protein,... 69 5e-10 ref|XP_002531694.1| pentatricopeptide repeat-containing protein,... 69 5e-10 ref|XP_004163208.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_004149415.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_006447755.1| hypothetical protein CICLE_v10014182mg [Citr... 61 2e-07 ref|XP_004139858.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 >ref|XP_003633341.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Vitis vinifera] Length = 822 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/53 (67%), Positives = 43/53 (81%) Frame = -1 Query: 476 LKEGESDSCMKFLHIMESRNSTPNFQTYVILARELAKEEKSIETDCVADKLSI 318 LKEGE D CMK LHIMES+N TPN QTYVIL REL++ KSIE++ +ADKL + Sbjct: 765 LKEGELDLCMKLLHIMESKNFTPNIQTYVILGRELSRIGKSIESEPLADKLKV 817 >emb|CAN78867.1| hypothetical protein VITISV_041982 [Vitis vinifera] Length = 962 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/53 (67%), Positives = 43/53 (81%) Frame = -1 Query: 476 LKEGESDSCMKFLHIMESRNSTPNFQTYVILARELAKEEKSIETDCVADKLSI 318 LKEGE D CMK LHIMES+N TPN QTYVIL REL++ KSIE++ +ADKL + Sbjct: 905 LKEGELDLCMKLLHIMESKNFTPNIQTYVILGRELSRIGKSIESEPLADKLKV 957 >ref|XP_006856878.1| hypothetical protein AMTR_s00055p00197790 [Amborella trichopoda] gi|548860812|gb|ERN18345.1| hypothetical protein AMTR_s00055p00197790 [Amborella trichopoda] Length = 940 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/50 (64%), Positives = 41/50 (82%) Frame = -1 Query: 476 LKEGESDSCMKFLHIMESRNSTPNFQTYVILARELAKEEKSIETDCVADK 327 LKEG S+ C+KFLH ME + TPNFQTYVILARE++KE+K ET+ +A+K Sbjct: 882 LKEGNSEMCLKFLHEMEEKGCTPNFQTYVILAREMSKEDKLPETELLANK 931 >ref|XP_007049305.1| Pentatricopeptide repeat-containing protein, putative isoform 2 [Theobroma cacao] gi|590712142|ref|XP_007049306.1| Pentatricopeptide repeat-containing protein, putative isoform 2 [Theobroma cacao] gi|508701566|gb|EOX93462.1| Pentatricopeptide repeat-containing protein, putative isoform 2 [Theobroma cacao] gi|508701567|gb|EOX93463.1| Pentatricopeptide repeat-containing protein, putative isoform 2 [Theobroma cacao] Length = 716 Score = 69.3 bits (168), Expect = 5e-10 Identities = 36/53 (67%), Positives = 40/53 (75%) Frame = -1 Query: 476 LKEGESDSCMKFLHIMESRNSTPNFQTYVILARELAKEEKSIETDCVADKLSI 318 LKEGESD CMK LH+MESRN PNFQTYVILARE +K IE D + +KL I Sbjct: 660 LKEGESDLCMKLLHVMESRNCPPNFQTYVILAREFSK-YGLIEVDQIGNKLRI 711 >ref|XP_007049304.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508701565|gb|EOX93461.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 909 Score = 69.3 bits (168), Expect = 5e-10 Identities = 36/53 (67%), Positives = 40/53 (75%) Frame = -1 Query: 476 LKEGESDSCMKFLHIMESRNSTPNFQTYVILARELAKEEKSIETDCVADKLSI 318 LKEGESD CMK LH+MESRN PNFQTYVILARE +K IE D + +KL I Sbjct: 853 LKEGESDLCMKLLHVMESRNCPPNFQTYVILAREFSK-YGLIEVDQIGNKLRI 904 >ref|XP_002531694.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528670|gb|EEF30685.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 821 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/51 (62%), Positives = 42/51 (82%) Frame = -1 Query: 476 LKEGESDSCMKFLHIMESRNSTPNFQTYVILARELAKEEKSIETDCVADKL 324 L+EG+SD CMKFL++MESRN TP+ TY+ILAREL+K KSI TD + ++L Sbjct: 764 LQEGDSDLCMKFLYLMESRNCTPSLHTYIILARELSKVGKSIGTDQIGNRL 814 >ref|XP_004163208.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Cucumis sativus] Length = 830 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/53 (56%), Positives = 41/53 (77%) Frame = -1 Query: 476 LKEGESDSCMKFLHIMESRNSTPNFQTYVILARELAKEEKSIETDCVADKLSI 318 LKEGE+D C+K LH+MESRN T NFQTYV+LAREL+ + +I+ ++ +L I Sbjct: 775 LKEGETDLCLKLLHVMESRNCTLNFQTYVMLARELSALDCAIKIPQISQQLGI 827 >ref|XP_004149415.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Cucumis sativus] Length = 830 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/53 (56%), Positives = 41/53 (77%) Frame = -1 Query: 476 LKEGESDSCMKFLHIMESRNSTPNFQTYVILARELAKEEKSIETDCVADKLSI 318 LKEGE+D C+K LH+MESRN T NFQTYV+LAREL+ + +I+ ++ +L I Sbjct: 775 LKEGETDLCLKLLHVMESRNCTLNFQTYVMLARELSALDCAIKIPQISQQLGI 827 >ref|XP_006447755.1| hypothetical protein CICLE_v10014182mg [Citrus clementina] gi|568830449|ref|XP_006469511.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Citrus sinensis] gi|557550366|gb|ESR60995.1| hypothetical protein CICLE_v10014182mg [Citrus clementina] Length = 929 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/50 (58%), Positives = 38/50 (76%) Frame = -1 Query: 470 EGESDSCMKFLHIMESRNSTPNFQTYVILARELAKEEKSIETDCVADKLS 321 +G D C+KFLHIMESRN N QTYVILA EL+K +KSI+TD + +++ Sbjct: 864 KGLPDLCLKFLHIMESRNCCINLQTYVILANELSKVDKSIDTDHLVKRVN 913 >ref|XP_004139858.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Cucumis sativus] gi|449530677|ref|XP_004172320.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Cucumis sativus] Length = 839 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = -1 Query: 476 LKEGESDSCMKFLHIMESRNSTPNFQTYVILARELAKEEKSIETDCVADKLSI 318 LKEGE+D ++ LH+MESRN T NFQT V+LAREL+ SIE ++ +L I Sbjct: 769 LKEGETDLSLELLHVMESRNCTLNFQTRVMLARELSALGCSIEIPQISKQLGI 821