BLASTX nr result
ID: Akebia27_contig00037116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00037116 (513 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPE36727.1| hypothetical protein GLAREA_08890 [Glarea lozoyen... 75 1e-11 >gb|EPE36727.1| hypothetical protein GLAREA_08890 [Glarea lozoyensis ATCC 20868] Length = 110 Score = 74.7 bits (182), Expect = 1e-11 Identities = 40/74 (54%), Positives = 49/74 (66%), Gaps = 8/74 (10%) Frame = -1 Query: 435 LAFTLLLVGA-----NAQEADPCPKSEYACLDVIDSSLCLSSNA---AAGSAETLAKCVS 280 L F+ L+ A A E D CPK+EYAC DVI+SSLCLS A A G+ ET+AKCV Sbjct: 8 LTFSFALLSAVHALPTAVEEDLCPKTEYACFDVINSSLCLSQQATPGAGGTGETMAKCVE 67 Query: 279 YEGAASNLPGATKL 238 ++GAASNL G K+ Sbjct: 68 FDGAASNLSGGAKV 81