BLASTX nr result
ID: Akebia27_contig00037049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00037049 (359 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETN45370.1| hypothetical protein HMPREF1541_09201 [Cyphelloph... 58 2e-06 gb|EMC92473.1| hypothetical protein BAUCODRAFT_38543 [Baudoinia ... 56 6e-06 >gb|ETN45370.1| hypothetical protein HMPREF1541_09201 [Cyphellophora europaea CBS 101466] Length = 138 Score = 57.8 bits (138), Expect = 2e-06 Identities = 33/61 (54%), Positives = 36/61 (59%), Gaps = 11/61 (18%) Frame = +2 Query: 209 SKEYEGRDLLDIAKEAERDLNRNPVKLGTDN-----------QSDSTQDSGIDESAVNKF 355 SKEYEGRDL DIA EAERDLN GT + S ST +SGID+S NKF Sbjct: 2 SKEYEGRDLKDIAAEAERDLNDRRHNFGTQDGTGFGGKTVGGGSTSTDESGIDQSVTNKF 61 Query: 356 P 358 P Sbjct: 62 P 62 >gb|EMC92473.1| hypothetical protein BAUCODRAFT_38543 [Baudoinia compniacensis UAMH 10762] Length = 93 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/59 (52%), Positives = 38/59 (64%), Gaps = 9/59 (15%) Frame = +2 Query: 209 SKEYEGRDLLDIAKEAERDLNRNPVKL--GTDNQ-------SDSTQDSGIDESAVNKFP 358 S EYEG+D ++IAK+AERDLN + K GTD SDST +SG+DES KFP Sbjct: 2 SAEYEGKDPMEIAKQAERDLNSDSAKRGHGTDGTNVLSMGGSDSTAESGVDESVTEKFP 60