BLASTX nr result
ID: Akebia27_contig00036995
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00036995 (477 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EJP66941.1| HMG box protein [Beauveria bassiana ARSEF 2860] 69 7e-10 gb|EFW98576.1| nucleosome-binding protein [Grosmannia clavigera ... 69 7e-10 ref|XP_003843357.1| hypothetical protein LEMA_P074670.1 [Leptosp... 69 9e-10 ref|XP_006667490.1| nucleosome binding protein [Cordyceps milita... 68 1e-09 ref|XP_001938916.1| non-histone chromosomal protein 6 [Pyrenopho... 68 1e-09 ref|XP_001798689.1| hypothetical protein SNOG_08374 [Phaeosphaer... 68 1e-09 emb|CCX12627.1| Similar to Non-histone chromosomal protein 6; ac... 67 2e-09 ref|XP_002838655.1| hypothetical protein [Tuber melanosporum Mel... 67 2e-09 ref|XP_001229234.1| conserved hypothetical protein [Chaetomium g... 67 3e-09 ref|XP_007581709.1| putative nucleosome binding protein [Neofusi... 67 3e-09 gb|ENH86198.1| nucleosome binding protein [Colletotrichum orbicu... 67 3e-09 gb|EKG19868.1| High mobility group HMG1/HMG2 [Macrophomina phase... 67 3e-09 ref|XP_003659464.1| hypothetical protein MYCTH_2296547 [Myceliop... 67 3e-09 ref|XP_003652125.1| hypothetical protein THITE_126111 [Thielavia... 67 3e-09 ref|XP_003350917.1| hypothetical protein SMAC_04223 [Sordaria ma... 67 3e-09 ref|XP_001905127.1| hypothetical protein [Podospora anserina S m... 67 3e-09 ref|XP_957906.2| hypothetical protein NCU09995 [Neurospora crass... 67 3e-09 sp|Q7S045.1|NHP6_NEUCR RecName: Full=Non-histone chromosomal pro... 67 3e-09 gb|EQL36251.1| hypothetical protein BDFG_02219 [Ajellomyces derm... 67 3e-09 ref|XP_003854760.1| HMGB family protein [Zymoseptoria tritici IP... 67 3e-09 >gb|EJP66941.1| HMG box protein [Beauveria bassiana ARSEF 2860] Length = 96 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 3 FGEVGKILGERWKALSEKQRTPYEAKATADKKRY 104 FG+VGKILGERWKALS+KQRTPYEAKA ADKKRY Sbjct: 53 FGQVGKILGERWKALSDKQRTPYEAKAAADKKRY 86 >gb|EFW98576.1| nucleosome-binding protein [Grosmannia clavigera kw1407] Length = 94 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 3 FGEVGKILGERWKALSEKQRTPYEAKATADKKRY 104 FG+VGKILGERWKAL+EKQRTPYEAKA ADKKRY Sbjct: 52 FGQVGKILGERWKALNEKQRTPYEAKAAADKKRY 85 >ref|XP_003843357.1| hypothetical protein LEMA_P074670.1 [Leptosphaeria maculans JN3] gi|312219936|emb|CBX99878.1| hypothetical protein LEMA_P074670.1 [Leptosphaeria maculans JN3] Length = 71 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +3 Query: 3 FGEVGKILGERWKALSEKQRTPYEAKATADKKRY 104 FGEVGK+LGE+WKAL+EKQRTPYEAKA ADKKRY Sbjct: 20 FGEVGKVLGEKWKALNEKQRTPYEAKAAADKKRY 53 >ref|XP_006667490.1| nucleosome binding protein [Cordyceps militaris CM01] gi|346324407|gb|EGX94004.1| nucleosome binding protein [Cordyceps militaris CM01] Length = 96 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 3 FGEVGKILGERWKALSEKQRTPYEAKATADKKRY 104 FG+VGKILGERWKALSEKQR PYEAKA ADKKRY Sbjct: 53 FGQVGKILGERWKALSEKQRVPYEAKAAADKKRY 86 >ref|XP_001938916.1| non-histone chromosomal protein 6 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330923152|ref|XP_003300124.1| hypothetical protein PTT_11280 [Pyrenophora teres f. teres 0-1] gi|187986015|gb|EDU51503.1| non-histone chromosomal protein 6 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311325919|gb|EFQ91802.1| hypothetical protein PTT_11280 [Pyrenophora teres f. teres 0-1] Length = 106 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +3 Query: 3 FGEVGKILGERWKALSEKQRTPYEAKATADKKRY 104 FGEVGK+LGE+WKAL+EKQRTPYEAKA ADKKRY Sbjct: 55 FGEVGKLLGEKWKALNEKQRTPYEAKAAADKKRY 88 >ref|XP_001798689.1| hypothetical protein SNOG_08374 [Phaeosphaeria nodorum SN15] gi|160702095|gb|EAT84650.2| hypothetical protein SNOG_08374 [Phaeosphaeria nodorum SN15] Length = 106 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +3 Query: 3 FGEVGKILGERWKALSEKQRTPYEAKATADKKRY 104 FGEVGK+LGE+WKAL+EKQRTPYEAKA ADKKRY Sbjct: 55 FGEVGKMLGEKWKALNEKQRTPYEAKAAADKKRY 88 >emb|CCX12627.1| Similar to Non-histone chromosomal protein 6; acc. no. Q7S045 [Pyronema omphalodes CBS 100304] Length = 100 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 3 FGEVGKILGERWKALSEKQRTPYEAKATADKKRY 104 FG+VGK+LGERWKALSEKQR PYEAKA ADKKRY Sbjct: 49 FGQVGKVLGERWKALSEKQRQPYEAKAAADKKRY 82 >ref|XP_002838655.1| hypothetical protein [Tuber melanosporum Mel28] gi|295634611|emb|CAZ82846.1| unnamed protein product [Tuber melanosporum] Length = 103 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 3 FGEVGKILGERWKALSEKQRTPYEAKATADKKRY 104 FG+VGK+LGERWKALSEKQR PYEAKA ADKKRY Sbjct: 50 FGQVGKVLGERWKALSEKQRQPYEAKAAADKKRY 83 >ref|XP_001229234.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51] gi|88183315|gb|EAQ90783.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51] Length = 96 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 3 FGEVGKILGERWKALSEKQRTPYEAKATADKKRY 104 FG+VGKILGERWKALS+KQR PYEAKA ADKKRY Sbjct: 52 FGQVGKILGERWKALSDKQRAPYEAKAAADKKRY 85 >ref|XP_007581709.1| putative nucleosome binding protein [Neofusicoccum parvum UCRNP2] gi|485926581|gb|EOD50820.1| putative nucleosome binding protein [Neofusicoccum parvum UCRNP2] Length = 105 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = +3 Query: 3 FGEVGKILGERWKALSEKQRTPYEAKATADKKRY 104 FGEVGKILGERWKALSEKQR PYEAKA DKKRY Sbjct: 53 FGEVGKILGERWKALSEKQRAPYEAKAANDKKRY 86 >gb|ENH86198.1| nucleosome binding protein [Colletotrichum orbiculare MAFF 240422] Length = 103 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 3 FGEVGKILGERWKALSEKQRTPYEAKATADKKRY 104 FG+VGK+LGERWKAL++KQRTPYEAKA ADKKRY Sbjct: 53 FGQVGKLLGERWKALNDKQRTPYEAKAAADKKRY 86 >gb|EKG19868.1| High mobility group HMG1/HMG2 [Macrophomina phaseolina MS6] Length = 106 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = +3 Query: 3 FGEVGKILGERWKALSEKQRTPYEAKATADKKRY 104 FGEVGKILGERWKALSEKQR PYEAKA DKKRY Sbjct: 54 FGEVGKILGERWKALSEKQRAPYEAKAANDKKRY 87 >ref|XP_003659464.1| hypothetical protein MYCTH_2296547 [Myceliophthora thermophila ATCC 42464] gi|347006731|gb|AEO54219.1| hypothetical protein MYCTH_2296547 [Myceliophthora thermophila ATCC 42464] Length = 101 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 3 FGEVGKILGERWKALSEKQRTPYEAKATADKKRY 104 FG+VGKILGERWKALS+KQR PYEAKA ADKKRY Sbjct: 51 FGQVGKILGERWKALSDKQRAPYEAKAAADKKRY 84 >ref|XP_003652125.1| hypothetical protein THITE_126111 [Thielavia terrestris NRRL 8126] gi|346999387|gb|AEO65789.1| hypothetical protein THITE_126111 [Thielavia terrestris NRRL 8126] Length = 103 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 3 FGEVGKILGERWKALSEKQRTPYEAKATADKKRY 104 FG+VGKILGERWKALS+KQR PYEAKA ADKKRY Sbjct: 51 FGQVGKILGERWKALSDKQRAPYEAKAAADKKRY 84 >ref|XP_003350917.1| hypothetical protein SMAC_04223 [Sordaria macrospora k-hell] gi|380090684|emb|CCC04854.1| unnamed protein product [Sordaria macrospora k-hell] Length = 103 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 3 FGEVGKILGERWKALSEKQRTPYEAKATADKKRY 104 FG+VGKILGERWKALS+KQR PYEAKA ADKKRY Sbjct: 53 FGQVGKILGERWKALSDKQRAPYEAKAAADKKRY 86 >ref|XP_001905127.1| hypothetical protein [Podospora anserina S mat+] gi|170939808|emb|CAP65034.1| unnamed protein product [Podospora anserina S mat+] Length = 98 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 3 FGEVGKILGERWKALSEKQRTPYEAKATADKKRY 104 FG+VGKILGERWKALS+KQR PYEAKA ADKKRY Sbjct: 53 FGQVGKILGERWKALSDKQRAPYEAKAAADKKRY 86 >ref|XP_957906.2| hypothetical protein NCU09995 [Neurospora crassa OR74A] gi|553139160|gb|ESA43989.1| hypothetical protein, variant 1 [Neurospora crassa OR74A] gi|553139161|gb|ESA43990.1| hypothetical protein, variant 2 [Neurospora crassa OR74A] Length = 95 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 3 FGEVGKILGERWKALSEKQRTPYEAKATADKKRY 104 FG+VGKILGERWKALS+KQR PYEAKA ADKKRY Sbjct: 53 FGQVGKILGERWKALSDKQRAPYEAKAAADKKRY 86 >sp|Q7S045.1|NHP6_NEUCR RecName: Full=Non-histone chromosomal protein 6 gi|336464617|gb|EGO52857.1| Non-histone chromosomal protein 6 [Neurospora tetrasperma FGSC 2508] gi|350296712|gb|EGZ77689.1| Non-histone chromosomal protein 6 [Neurospora tetrasperma FGSC 2509] gi|553139162|gb|ESA43991.1| hypothetical protein NCU09995 [Neurospora crassa OR74A] Length = 103 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 3 FGEVGKILGERWKALSEKQRTPYEAKATADKKRY 104 FG+VGKILGERWKALS+KQR PYEAKA ADKKRY Sbjct: 53 FGQVGKILGERWKALSDKQRAPYEAKAAADKKRY 86 >gb|EQL36251.1| hypothetical protein BDFG_02219 [Ajellomyces dermatitidis ATCC 26199] Length = 127 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 3 FGEVGKILGERWKALSEKQRTPYEAKATADKKRY 104 FG+VGK+LGERWKAL+EKQR PYEAKA ADKKRY Sbjct: 51 FGQVGKVLGERWKALNEKQRAPYEAKAAADKKRY 84 >ref|XP_003854760.1| HMGB family protein [Zymoseptoria tritici IPO323] gi|339474644|gb|EGP89736.1| HMGB family protein [Zymoseptoria tritici IPO323] Length = 111 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 3 FGEVGKILGERWKALSEKQRTPYEAKATADKKRY 104 FGEVGK+LGERWK L+EKQ+TPYEAKA ADKKRY Sbjct: 56 FGEVGKLLGERWKGLNEKQKTPYEAKAAADKKRY 89