BLASTX nr result
ID: Akebia27_contig00036950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00036950 (400 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOO04121.1| hypothetical protein UCRPA7_404 [Togninia minima ... 57 2e-06 >gb|EOO04121.1| hypothetical protein UCRPA7_404 [Togninia minima UCRPA7] Length = 68 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/68 (48%), Positives = 40/68 (58%) Frame = +2 Query: 35 MSGITDEAAVAEHDLIDRAEKEEAKTHEGQTGSTASTDSQKKTTGQGDLTSKAQSVVEQA 214 MSGITDEAAVAEHDLI AE + K Q+ + QKK+ G G+ K S VE+ Sbjct: 1 MSGITDEAAVAEHDLIQHAEDDLNKAQGNQSNPVSGDPEQKKSYGLGE-APKQTSKVEKV 59 Query: 215 KETLGLKK 238 KE L + K Sbjct: 60 KEALHINK 67