BLASTX nr result
ID: Akebia27_contig00036871
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00036871 (546 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB67213.1| hypothetical protein L484_025691 [Morus notabilis] 58 2e-06 >gb|EXB67213.1| hypothetical protein L484_025691 [Morus notabilis] Length = 266 Score = 57.8 bits (138), Expect = 2e-06 Identities = 41/108 (37%), Positives = 56/108 (51%), Gaps = 7/108 (6%) Frame = -1 Query: 546 EQRARNKSLKRMKFDLQSQS-AKQKSTIELSKEAFCDQS---DRTCK---ILPINQSIDL 388 +QR N+SL RMK DL+SQ K + LS +A DQ D C+ I+P + + Sbjct: 159 KQRVTNESLNRMKLDLESQQKTKTVTAFALSDKAITDQPKQVDSVCEPQSIMPTDVHCNG 218 Query: 387 VCXXXXXXXSFEVENKDDIATQENFFALPDLNLPLEDDSGSEI*YGMS 244 + S E ++ +E F+LPDLNLP E D GSE+ GMS Sbjct: 219 LDALERSCASNESRKLKELEARETAFSLPDLNLPAEGDLGSEVLCGMS 266