BLASTX nr result
ID: Akebia27_contig00036656
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00036656 (388 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006857211.1| hypothetical protein AMTR_s00065p00199990 [A... 57 2e-06 >ref|XP_006857211.1| hypothetical protein AMTR_s00065p00199990 [Amborella trichopoda] gi|548861294|gb|ERN18678.1| hypothetical protein AMTR_s00065p00199990 [Amborella trichopoda] Length = 647 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/104 (29%), Positives = 60/104 (57%), Gaps = 21/104 (20%) Frame = -3 Query: 383 MMVLDPFKKMEDNDHKLIQL---------------------GEKLHLRELEIETMKQRTR 267 MMV++P KKM++++ +L+ L G+ L +RE EI+ ++QR Sbjct: 432 MMVVEPLKKMDEDNQELLSLHRKVSKEIEHSKTLEETCNVIGQNLRIREQEIKIIRQRAT 491 Query: 266 EEIEKYQNEIDYLNNYYADTIKEMSNNNLEKIEMEHEEAQKSFR 135 E++E+ + E+DYL+ Y + I++++ +LEK E + E+ Q + + Sbjct: 492 EQLEESKEEMDYLDRIYEEKIRKLT-EDLEKREKQLEKVQDALK 534